KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c00730Help
Entry
SS05631_c00730    CDS       T05069                                 

Definition
(GenBank) Pyridoxal-5'-phosphate phosphatase, Alphaproteobacterial type
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
sino  Sinorhizobium sp. CCBAU 05631
Brite
KEGG Orthology (KO) [BR:sino00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SS05631_c00730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ASY55035
UniProt: A0A249NND8
LinkDB All DBs
Position
complement(74070..74783)
Genome map
AA seq 237 aa AA seqDB search
MKKLDRLPTHAEFAHVTEWVFDLDNTLYPHHVNLFAQIDRNMTAYVAELLSLEPSEAKKL
QKEYYRDHGTTLQGLMLHHGIDPNDFLERAHAIDYSVVPANPDLGEAIKALPGRKFIFTN
GSVAHAQMTARALGILDHFDDIFDIVAAGYLPKPAGDTYDKFMSLHRVDTQHAAMFEDLP
RNLLVPKALGMTTILLVPRNLEYEFAEAWETSSDADEQIDYVTEDLAGFLRRVVAAD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctcgaccgcctgccgacccacgccgaattcgcccatgtcaccgagtgggtc
ttcgatctcgacaacacgctctacccgcatcacgtcaatctcttcgcgcagatcgaccgc
aacatgacggcctatgtggccgaactcctgtcgctcgagccctcggaggcaaagaagctg
cagaaggaatattaccgcgatcacggcacgaccctgcagggcctgatgctccatcacggc
atcgatccgaacgattttctcgaacgggcgcatgcgatcgactacagcgtggtgccggca
aatcccgatctcggcgaggcgatcaaggcactccccggccgcaagttcatcttcaccaat
ggcagcgtcgcccatgcgcagatgacggcccgcgcgctcggcattctcgaccatttcgat
gacattttcgacatcgtcgccgccggctacctgccgaagccggccggcgatacctacgac
aagttcatgagcctgcaccgcgtcgacacgcagcatgcagcaatgttcgaggacctgccg
cgcaacctgctggtcccgaaggccctcggcatgacgaccatcctgctggtgccgcgcaat
ctcgaatatgagttcgcggaagcctgggagacctccagcgacgccgacgagcagatcgat
tacgtcaccgaggatctcgccggcttcctgcgccgcgtggtggcggcggactaa

DBGET integrated database retrieval system