KEGG   Streptococcus iniae ISNO: DW64_03775
Entry
DW64_03775        CDS       T03286                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sio  Streptococcus iniae ISNO
Pathway
sio00010  Glycolysis / Gluconeogenesis
sio00020  Citrate cycle (TCA cycle)
sio00620  Pyruvate metabolism
sio01100  Metabolic pathways
sio01110  Biosynthesis of secondary metabolites
sio01120  Microbial metabolism in diverse environments
sio01200  Carbon metabolism
Module
sio_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DW64_03775
   00020 Citrate cycle (TCA cycle)
    DW64_03775
   00620 Pyruvate metabolism
    DW64_03775
Enzymes [BR:sio01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DW64_03775
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B DUF2344
Other DBs
NCBI-ProteinID: AHY17462
UniProt: A0A023VQ92
LinkDB
Position
763960..765375
AA seq 471 aa
MAVEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMEIEAEETGVLLKIV
RQAGDAVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPNSADAAPAVAPKVETEVPEVAV
AKTAIPQEDGAKVRATPAARRVAAELGINLRQVAGTGPFGRVHQDDVENFKNAQPKASPL
ARKMAEAEGLDLADIKGSGYNGKVMKEDILAAILATKPAQETAKPAAAKEELKAELPEGV
EVIKMSAMRKAISKGMTNSYLTAPSFTLNYDIDMTEMMAFRKKLIDPIMNKTGLKVSFTD
LIGMAVVKTLMKPEHKFLNASLINDAQEIELHEFVNIGIAVGLDGGLIVPVVHGADKMSL
ADFVVASKDVIKKAQNGKLKSNEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATI
PTPTVVNGEIVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFELLI
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggctgttgaaattataatgccaaaactcggtgttgatatgcaagaaggtgaaatcatc
gagtggaaaaaacaagaaggtgatgttgtcaacgagggcgatattcttcttgaaattatg
tctgataaaacaaatatggaaattgaagctgaggagacgggtgttcttttaaaaatcgtt
cgtcaagctggtgatgctgtccctgtaacggaagttattggttacattggagctgaagga
gagtctgtagacacgattgcttcaagtgaaaaaacaactgaaattccagttcctaactca
gctgatgcagcaccggctgttgcgccaaaagtagagactgaagttccagaagttgctgtt
gctaaaacagctatccctcaagaagatggtgccaaagttcgtgcaacacctgctgcaaga
cgtgtagctgcagaacttggtattaacttaagacaagttgctggaacaggtccatttgga
cgtgttcaccaagacgatgttgagaacttcaaaaatgctcaaccaaaagcgtcaccactt
gctcgtaagatggctgaagctgagggtcttgatttggctgacatcaagggaagtggttat
aatggcaaggttatgaaagaagatattcttgctgctattttagctacaaaacctgcacaa
gaaacagctaaaccagcagcagctaaagaagagcttaaagcagaattacctgaaggcgtt
gaagttattaagatgtctgcaatgcgtaaagcaatctctaaaggtatgactaactcatac
ttaacagctccgtcatttacattgaattacgatattgacatgacagagatgatggctttc
cgtaaaaaattaattgatccaatcatgaacaaaacaggtttgaaagtcagctttactgat
ttgattggtatggcagttgtcaaaacattaatgaaacctgagcataagttcctaaatgca
tcattaattaatgacgctcaagaaatcgaacttcatgaatttgttaatattggtatcgcc
gttggtttagacggtggacttattgtaccagttgtacacggtgcagacaaaatgtcactt
gctgattttgttgttgcttctaaagacgttatcaaaaaagcacaaaatggtaagttgaaa
tcaaacgaaatgtcaggatcaacattctcaattacaaacttgggaatgtttggaaccaag
acatttaacccaattattaaccaacctaattctgcaatccttggtgtaggtgcaacgatt
ccaacaccaacagttgttaatggtgaaattgttgcgcgtccaatcatggcaatgtgcttg
accattgaccaccgtatcgtagatggtatgaatggtgctaaattcatggttgatcttaaa
aacttaatggaaaacccatttgaattattaatctga

DBGET integrated database retrieval system