KEGG   Shewanella japonica: SJ2017_1623Help
Entry
SJ2017_1623       CDS       T04959                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sja  Shewanella japonica
Pathway
sja00473  D-Alanine metabolism
sja00550  Peptidoglycan biosynthesis
sja01100  Metabolic pathways
sja01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SJ2017_1623
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SJ2017_1623
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SJ2017_1623
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sja01011]
    SJ2017_1623
Enzymes [BR:sja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SJ2017_1623
Peptidoglycan biosynthesis and degradation proteins [BR:sja01011]
 Precursor biosynthesis
  Amino acid ligase
   SJ2017_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ARD21936
LinkDB All DBs
Position
complement(1927658..1928680)
Genome map
AA seq 340 aa AA seqDB search
MTTFNVLLICGGGSAEHDVSVLSANFFESSLLQSNKINLLRVELDSNGHYFDSEGNSCEL
TNRREVRFDNDVKTPWTVDYVIPCIHGFPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNDYNQSAIEQTQAALSKWGSVFVKAASQGSSVGCYKVDSQ
EQIAQVLKDAFSFAPSVVVEKTIIARELEVAVYEYLGKVIATLPGEIICADNTFYTFDEK
YNASSKARTDVVAGNLSQQNIDKIREYALKAFTGMKLRHLSRIDFFLTDDGEILLNEINT
FPGSTPISMFPKMMQNHGENFTDYLVDNIETQLTSLNTIR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttttaacgttctccttatttgcggtggtggcagcgctgaacatgatgtatct
gtgctatcggctaacttttttgaatcgtcattattgcaatctaataaaatcaatctgcta
agagttgagttagatagcaacggtcattattttgatagtgaaggtaatagttgtgaatta
actaatcggcgtgaagtacgatttgataatgatgtcaaaacgccatggacagtggattac
gtcattccttgtattcatggtttccctggtgaaactggcgatattcaatcttattttaac
ttaattcaattaccttactttggttgtgagtcagaagcatcgagtaattgttttaataaa
atcaccgccaaaatgtggtttagtgcactgggcatcccgaacacgccttacatttttttg
aatgactataatcaatcagctattgagcaaacccaagcagcactatctaaatggggctca
gtgtttgtaaaagcagcttcccaaggctcatctgttgggtgctacaaagtcgatagccaa
gagcaaatagcacaagtgttaaaagatgcatttagttttgcaccttcagttgtggttgaa
aaaaccatcatagcgcgcgagttagaagtcgcagtatatgaatatctaggtaaagtcatc
gccacgttaccaggcgaaattatttgcgccgacaatactttttatactttcgatgaaaaa
tacaatgcttcaagcaaagctcgaactgatgtagttgcaggaaatttatcacaacaaaat
atcgataagatcagagaatacgccttaaaagcatttacaggtatgaagttacgtcatttg
tcgagaattgacttcttcttaactgatgacggtgaaattttattaaatgaaattaatacc
ttccctggttctacacccatctcaatgtttccaaaaatgatgcaaaatcatggtgaaaat
tttaccgactatctcgttgataatattgaaacgcagttaacatctcttaataccattcgt
taa

DBGET integrated database retrieval system