KEGG   Shewanella khirikhana: STH12_04041
Entry
STH12_04041       CDS       T06711                                 

Gene name
mraY
Definition
(GenBank) Phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
skh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_04041 (mraY)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    STH12_04041 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_04041 (mraY)
Enzymes [BR:skh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     STH12_04041 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Glycosyltransferase
   STH12_04041 (mraY)
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: AZQ13075
UniProt: A0A3S9LBW4
LinkDB
Position
4577619..4578701
AA seq 360 aa
MLVYLAEYLTQFYSGFNVFSYVTFRAILALLTALMFSLWWGPKLIERLQLLQIGQVVRND
GPESHFSKRGTPTMGGLLILAGIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKV
VRKDPKGLIARWKYIFQSLAAILVAFYLFYSAKHPGETQLVVPFFKDILPQLGLMFIVLT
YFTIVGASNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHVPYLPGSGELV
IVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIAVLVRQEILLVIMGGVFVME
TLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLGLATLKLR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctggtttatctggccgagtatctgacccagttttactctgggttcaacgtattttcc
tatgtgaccttcagggccattctggcgctgctgactgcgcttatgttcagcctctggtgg
gggccaaaactgattgagcgcctgcagttgctgcaaatcggccaggtggttcgcaacgac
ggcccagagtctcatttcagtaagcgcggcaccccaaccatggggggtttgctgatcctc
gccggtatctttatcagtgtgctgctgtggggcgatttgggcagccgctacgtgtgggtc
atgctgtttgtgctgggctcattcggtctgattggctttatcgacgattaccgcaaagtg
gttcgcaaagatcccaagggcctgattgcccgctggaaatacattttccagtcgctggcg
gccattctggttgccttttacctgttctattcggccaagcatccgggcgaaacccaactg
gtggtgcctttcttcaaagacattctgccgcagcttggactgatgttcattgtgctgact
tatttcaccattgtgggggccagtaacgcggtgaacctcaccgatggtctggatggtctg
gcgattatgcctaccgtgatggtggcggcggcctttgcgctgattgcctatctgtccggt
cacgtgcagtttgccaactatctgcacgtgccttacctgccgggctccggcgagctggta
atcgtctgtaccgccattgtgggcgcgggtctgggctttttgtggttcaacacttaccca
gctcaggtatttatgggcgatgtgggttcactgtcgctgggcgctgcacttggcaccatc
gctgtgttggttcgtcaggaaatcctgttggtgatcatgggcggcgtgttcgtgatggaa
accctgtcggtgatcctgcaggtgggttcgtacaagctgcgcggtcagcgaattttccgc
atggcaccaattcaccaccattatgagctcaagggctggccggagccgcgggtgattgtc
cgtttctggattatctccctgttcctggtgctgcttggtctggccacgttgaagctgagg
taa

DBGET integrated database retrieval system