KEGG   Saccoglossus kowalevskii (acorn worm): 100376944
Entry
100376944         CDS       T04123                                 

Definition
(RefSeq) stearoyl-CoA desaturase 5-like
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko01040  Biosynthesis of unsaturated fatty acids
sko01100  Metabolic pathways
sko01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100376944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sko01004]
    100376944
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100376944
Lipid biosynthesis proteins [BR:sko01004]
 Desaturase
  First
   100376944
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-GeneID: 100376944
NCBI-ProteinID: XP_002739828
LinkDB
Position
Un
AA seq 333 aa
MAPRNDVFQNFEEEDSASDSSTTVLDDVVQTENVLRVPVKIVWRNVVLMGALHLAALYSL
FLIPSCRWQTLLFGIVLMRLGGLGITAGAHRLWAHRSYKARFPLRVFLALIQTLAFQNDI
FEWSRDHRVHHKYSETDADPHNAKRGFFFAHVGWLLSRKHPDVIRKGRSIDLSDLHADPV
VRFQRRVYKPAVLLLCFIIPTLLPTYWDESVWNSFYICALLRYTLSLHATWCVNSVAHMF
GNKPYDRYINPTENMMVVLGALGEGFHNFHHTFPSDYAAAEFGIQRCNTTKMLIDIWCFL
GLAYDRKSTSIDVVKKRKIRTGDGTNHTALLYT
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcaccgagaaacgacgtatttcaaaacttcgaggaggaagactcagcgtctgattcg
tctacaacagtattggacgatgtcgttcagaccgagaacgtgttacgcgttcccgttaaa
atcgtctggaggaacgtagtgctgatgggtgctctgcatctagccgcactgtattcgtta
tttctcattccttcctgtcgttggcagactttactcttcggcattgtcttgatgcggctt
ggtggacttggcataactgctggtgcacatcgtctgtgggctcatcgttcatacaaagca
aggtttccacttcgtgttttccttgctctaattcaaaccttggccttccagaatgatata
tttgaatggtcacgtgaccatcgagtacatcataaatactcggaaactgatgcggatccg
cacaatgctaaacgtggtttcttctttgcacatgtgggatggctactatctcgaaaacac
cccgacgtcataaggaaagggaggtcaattgaccttagtgatctgcatgcagatcctgtt
gttagatttcaaaggagagtttataaacctgccgttcttttgctgtgtttcatcattccg
actttactaccgacatactgggacgaatcagtctggaattctttctacatctgcgcactg
ctacggtacactctctctttacatgccacgtggtgtgtcaacagtgtagctcacatgttt
ggtaacaagccttacgatagatacattaacccaacagagaacatgatggttgttcttggt
gcgcttggcgaagggttccataacttccatcatacattccctagtgattatgcagcggcc
gagtttggaattcagcgctgcaacactacgaaaatgttaattgacatttggtgctttttg
ggattggcttatgaccgaaaaagcacaagtattgacgtggtaaagaagagaaaaatacgc
actggtgatggtactaatcacactgctttgctttatacctaa

DBGET integrated database retrieval system