KEGG   Sphingomonas koreensis: BRX40_17275Help
Entry
BRX40_17275       CDS       T04828                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
skr  Sphingomonas koreensis
Pathway
skr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:skr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BRX40_17275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:skr03400]
    BRX40_17275
Enzymes [BR:skr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BRX40_17275
DNA repair and recombination proteins [BR:skr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BRX40_17275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: APR53927
UniProt: A0A1L6JDL6
LinkDB All DBs
Position
3576833..3579349
Genome map
AA seq 838 aa AA seqDB search
MTAANPLDIYNAKRDFTRTKEPRGKVAKKRGNSFVVQKHAATRLHWDFRLEIDGVLKSWA
VTKGPSCDPADKRLAVRTEDHPLDYGEFEGNIPKGEYGGGTVMLWDRGTWEPVAGKRADD
LEDGHLHFVLHGERMKGEWLLVRMKGRPGEKRENWLLRKIDDAEAGQGDTLVERGLTSVL
TGRSLAQIEADTAGTQSLKGIKGKAFARKMQAAKVHNARIGGKAQEKRKSRAAPLPRFVK
PQLATLVDDVPTGNEWLHEIKYDGYRLLIAARGGEVKVYTRNGLDWTAKFGPLVQTIAAL
DLPPALIDGEVVAFDANGNPSFSVLQSVLKRGHGEQRADTPFHFFAFDLLSLDGADLKPL
PLIERKERLEALLAHAESPIRVADHLIGAGERLYRSLCDAGQEGIIAKRIDDAYRSGRTR
NWVKVKCTRRQEFVVIGWTASKAKGRAFASLLLAQHEGKTLTYKGKVGTGFDSGTMDELA
AAMKPLATRDAPAEVPRVEARGAHWIEPKLVAEVAFAEFTGDGRVRHGSFLGLRTDKPAK
SVKPEKPAPAPPPESGVKISSRERVIFPDSGQTKGDLADYYARIAPLMLPFAANRPVSLV
RCPQGRSRNCFFQKHDSGAFGDHVHHVPIREKDGGTEDYIYVDDADGLLACVQMGTIEFH
GWASRADAVELPDRMIFDLDPDEGMDFARVRTAAADIRDQLSAIGLVSFAMLSGGKGVHV
VVPLTPGHDWETHKDFASRLAHALSAAEPDRFVATMSKAKRKGRIFIDWLRNQRGSTAIL
PYSARARAGAPVAIPIDWTELSGMKDAHPFDIGDAETLWERSNMLKGWGFAAQRLPQL
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcgaaccccctggatatctacaacgctaaacgtgacttcacccgcacgaag
gaacccaggggcaaggtcgcgaagaagcgcggcaacagcttcgtcgtccagaagcacgcc
gcgacgcggcttcactgggatttccggctcgagatcgacggcgtcctcaagagctgggcg
gtcacaaagggcccgagctgcgaccccgccgacaagcgcctggcggtccgcaccgaggat
cacccgctcgactatggggagttcgaggggaatatcccgaaaggcgaatatggcggcggc
accgtcatgctgtgggatcgcggcacctgggagccggtcgctggcaagcgcgccgacgac
ctcgaggacggccatctccacttcgtcctccatggcgagcggatgaaaggcgaatggctg
ctggtgcgcatgaagggtcgcccgggcgagaagcgcgagaactggctgctacgcaagatc
gacgatgcggaggcgggccagggcgacacgctggtcgaacgcggcctgaccagcgtgctc
accggccggtcgctggcgcagatcgaggcggacaccgccggcacccagtcgctcaagggc
atcaagggcaaggcattcgcccggaagatgcaggcggcgaaagtgcacaatgcccgcatc
gggggcaaggcacaggaaaagaggaagtcgcgcgcggccccgcttccccgcttcgtcaag
ccgcagctggcgacgctggtcgatgatgtgcccaccggcaatgagtggctgcacgaaatc
aaatatgacggctatcgcctgctgatcgcggcgcgcggcggcgaagtgaaggtctacacc
cgcaacggcctagactggaccgccaagttcggccctctggtacagaccatcgccgcgctc
gaccttccgcccgcgctgatcgacggcgaggtggtcgctttcgatgcgaacggcaatcct
agcttctccgtgctgcaatcggtgctcaagcgcggccacggcgaacagcgcgctgacacg
ccctttcacttcttcgccttcgacctgctctcgctcgacggagccgacctcaagccgctg
cccctgatcgagcgcaaggagcggctggaagcgctgctcgcccatgccgagtcaccgatc
cgagttgccgatcacctgatcggcgcgggggaaaggctctaccggtcgctatgcgatgcg
gggcaggaagggatcatcgccaagcgcatcgacgacgcctatcgcagcggtcgcactcgc
aactgggtcaaggtcaaatgcacccgccggcaggaattcgtggtgatcggctggaccgcg
agcaaggcgaagggccgcgccttcgcctcgctcctcctcgcccagcacgaggggaagacg
ctgacctacaagggcaaggtcggcaccggcttcgactcgggcacgatggacgaactcgcc
gccgcgatgaaaccgctcgccacccgggacgcccccgccgaagttccccgcgtcgaggcg
cgcggcgcgcactggatcgagccgaagctggtcgcggaggtcgccttcgccgaattcacc
ggtgacggtcgcgtccgccatggcagcttcctcggcctgcgcaccgacaagccggcaaag
tctgtgaaaccggaaaagccggcccccgcgccgccgcccgagagcggggtgaagatcagc
agccgcgaacgcgtcatcttccccgacagcggtcagaccaagggcgatctggccgactat
tatgcgcgcatcgccccgctgatgctccccttcgccgccaaccgcccggtcagcctggtc
cgctgcccgcaggggcgctccaggaactgcttcttccagaagcacgacagcggcgcattc
ggcgatcatgtccatcacgtgccgatccgcgagaaggacggcgggacagaggactatatc
tatgtcgacgatgccgacggcctcctcgcctgcgtccagatgggaacgatcgaattccat
ggctgggcgtctcgcgccgacgcggtcgaactgcccgaccggatgatcttcgacctcgat
ccggacgagggcatggacttcgcccgcgtgcggacggctgccgccgacatccgcgaccag
ctgagcgcaatcggtctcgtctcctttgccatgttgtcggggggcaagggcgtgcatgtc
gtcgtgccgctgacgcctggtcatgactgggaaacgcacaaggatttcgcttcccgctta
gcccatgcgcttagcgcggccgaaccggatcgcttcgtcgcgacgatgagcaaggcgaag
cgcaagggccgtatcttcatcgactggcttcgcaaccagcgcggcagcaccgcgatcctg
ccctattccgcgcgggcgcgggcaggcgcgcctgtcgcgataccgatcgactggaccgag
ctttcggggatgaaggacgcgcacccgttcgatatcggggacgccgaaacgctgtgggaa
cggtcgaatatgctgaaaggctggggcttcgcggcgcagcgattgccgcaactatga

DBGET integrated database retrieval system