KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111653812
Entry
111653812         CDS       T06058                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 111653812
NCBI-ProteinID: XP_023260278
LinkDB
Position
Unknown
AA seq 365 aa
MSCGEFIELRDLRNNREQIELTSTHSPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
STQDPQLKEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
QLDCSLDEGSVSDQTCVVEHTIETDTNVDEQIDCGKQELTTADIQQKVKEYNSQINSNLF
MNMNKDGSYTGFVKVQFKLVRPVSVPHPKKGGQDAGGRKASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDAERPLRLRLCAGPS
EKVLSFVIKENETGEVNWHAFSMPELKNFLRILQREEEEHVKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttgtggggagttcattgagctacgtgacctgcgcaacaacagagaacagatagag
ctgacaagcacacattcaccctgctcccctcctcgactggagagaaccaacgccctgagg
atcagcccggggaaggtcccagacctgctgagccgggtgggcatcatcagagtcctgagc
agcacccaggacccccagctcaaagaggagaagggagagggacacaacttccaaccctgc
agccacgctcagcccacgtggtgtgacctgtgtggagacttcatctggggcctttacaag
cagagcctgcggtgtgtcaattgtagattcacatgccactaccgctgtcgagccctgatc
cagttggactgcagcttggacgaaggctctgtgtccgaccaaacatgtgttgtggagcac
accatagaaacggacacaaatgtggatgaacaaattgactgtgggaagcaggagttgaca
actgcagatatccagcagaaggtcaaggaatacaacagtcagatcaacagcaatctgttc
atgaacatgaacaaggatggttcgtacactggcttcgtaaaggtgcagtttaagttggtg
cgacctgtgtcggttccacatccaaagaaagggggtcaagatgctggagggaggaaggct
agcggagtgaagcgtcgcacctctttttacctgccaaaggatgcatccaagcacctgcac
ataagctcccgcacctctgcccgtgaggtcattgaggctttactgaaaaagtttactgtg
gtggacaatcctggcaaatttgctctgtttgagcgtagcgagcgtcatgaccaggtttat
gttcgcaagctgtctgatgctgaacgtcccctccgtctgcgtctgtgtgctgggccgagt
gagaaagtcctcagttttgtgatcaaagaaaacgaaactggagaggtcaattggcatgcc
ttctctatgcctgagttaaagaacttcctgcgcattctgcagcgtgaagaagaggaacac
gtcaagcagatagtgcagcgatacgctctggcccgcactaagatgcaggaggcgctggct
ggctccacccctggttga

DBGET integrated database retrieval system