KEGG   Streptomyces lydicus A02: T261_1640Help
Entry
T261_1640         CDS       T03756                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00511  Other glycan degradation
sld00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    T261_1640
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    T261_1640
Enzymes [BR:sld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     T261_1640
Bacterial toxins [BR:sld02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   T261_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 Laminin_G_2 BNR DUF4185 Laminin_G_1
Motif
Other DBs
NCBI-ProteinID: AJT63325
UniProt: A0A0D4DHJ5
LinkDB All DBs
Position
1733764..1735674
Genome map
AA seq 636 aa AA seqDB search
MAGLAALTAGVLAVLPVTPAQAAPDPAPETAPPAPAGGFDQQVLFTAAREKGYSCFRIPA
IVKTRRGTVLAFAEGRVHDCGDAGDIDLVLKRSTDGGRTWGPLQVINHGDGDTHGNPAPL
VDRRTGRIVIAETYNKGRTDGLSCDVPCDRTPHLQYSDDDGATWSAPRDLTPTIRPPEWN
SWYATGPVHGIQLTRGRHAGRLVVGINAESYAQGRVTENHAALVHSDDSGRTWKVGALDT
WPIAGDGTFRQKPSEMTLLERTDGSIYVNGREQDGTDLGHRTAAVSRDGGDSFTGPFRAI
PDLYSPMVQASALRLPRSRSAGRGHTRTLFAAPADPDRRRTMTIRSSWDEGRTWEGVDRG
ARVTTDWSGYSDMAALSPDVTGLLYEGGKADAREEIRFVRFTEEWLGPRRGPDPTTPDDA
PGARPALVLGGARSTDGVFGDALAFDGKDDAVRLPYRDSLPLGTHDFTCSLFFRYDATTG
EQPMLWMGGVGSRSPQVAVSADPAHHRITAHITAVDGARPPVTAQVVSNGAYNDGRWHHL
ALRRTGGRLMLTVDLVDTTSVPDVPGSVSRGSVFGVHLGQKVDSRAQFTGALDEVSVYRR
ALTDEQLTGVGTSDAAAGGPLVLRLALDRVHGGDQG
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
gtggccggtctcgccgcgctcaccgccggcgtcctcgccgttctccccgtcacccccgca
caggccgcgcccgatccggcgccggagacggctcccccggcccccgccgggggcttcgac
cagcaggttctcttcaccgccgcgcgcgagaagggctattcctgcttccgcataccggcg
atcgtcaagacccgccgcggcaccgtcctcgcgttcgccgagggccgggtgcacgactgc
ggcgacgcgggcgacatcgacctcgtgctcaaacgctccaccgacggcggccgcacctgg
ggcccgctccaggtgatcaaccacggtgacggcgacacgcacggcaacccggcccccctc
gtggaccgccgcaccggccgcatcgtcatcgccgagacctacaacaagggccgcaccgac
ggcctgagctgcgatgtcccctgtgaccgcaccccgcacctgcagtacagcgacgacgac
ggcgccacctggtccgcgccccgggacctgacccccaccatccggccgcccgagtggaac
tcctggtacgccaccgggcccgtccacggcatccagctcacccggggccggcacgcgggc
cgtctggtcgtcggcatcaacgcggagagctacgcccagggccgggtcaccgagaaccac
gcggccctggtgcacagcgacgacagcggccgcacctggaaggtcggcgcgctggacacc
tggccgatcgccggggacggcacgttccgtcagaagccctccgagatgacgctcctggag
cgcaccgacggctcgatctacgtgaacggccgcgaacaggacggtacggacctgggccac
cgcaccgccgccgtcagccgcgacggcggcgactccttcaccgggccgttccgcgcgatc
cccgacctctactcccccatggtgcaggcctcggcgctgcgcctgccccgctcccggtcc
gccggccgcggccacacccgcaccctcttcgccgcacccgccgaccccgaccggcgccgc
accatgaccatccgctcctcctgggacgagggccgcacctgggagggcgtcgaccggggc
gcacgggtcaccaccgactggtccggctactccgacatggccgccctctcccccgacgtc
accggcctgctctacgagggcggcaaggccgacgcccgcgaggagatccgcttcgtccgc
ttcaccgaggagtggctcgggccgcgccgcggccccgaccccacgacccccgacgacgcc
ccgggcgcccgcccggcgctcgtcctgggcggcgcccgcagcaccgacggcgtcttcggc
gacgcgctggcctttgacggcaaggacgacgccgtacgcctcccgtaccgcgactcgctc
cccctcggcacccacgacttcacctgcagcctcttcttccgctacgacgccaccaccggg
gagcagccgatgctctggatgggcggcgtgggcagcagatcgccgcaggtcgcggtgagc
gccgaccccgcgcaccaccggatcaccgcccatatcaccgccgtcgacggcgcccggccg
cccgtcaccgcgcaggtcgtgtccaacggcgcatacaacgacggccgctggcaccatctc
gcgctgcgccgtaccggcggccggctgatgctcaccgtggacctcgtcgacaccacgagt
gtcccggacgtcccgggctcggtgagccgcggctcggtcttcggcgtccatctcgggcaa
aaggtggacagccgcgcccagttcacgggcgcgctggacgaggtcagcgtctaccggcgg
gccctgaccgatgagcagctgaccggggtcggcacctccgacgctgccgccgggggaccg
ctggtgctgcggctggcgctcgaccgggtgcacgggggcgaccagggctga

DBGET integrated database retrieval system