KEGG   Streptomyces leeuwenhoekii: sle_28980Help
Entry
sle_28980         CDS       T04414                                 

Gene name
sle_28980
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00564  Glycerophospholipid metabolism
sle01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    sle_28980 (sle_28980)
Enzymes [BR:sle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     sle_28980 (sle_28980)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CQR62359
UniProt: A0A0F7VPW0
LinkDB All DBs
Position
chromosome:complement(3495571..3497277)
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAQRAESLAAMAERELDVLVVGAGVVGAGTALDAATRGLATGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLRHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLTRRHALRVAPCLKKDALVGALQYYDAQMDDARF
VATLVRTAAAYGALTANRARVTGFLREGERVVGARVQDVEAGGEYEIRAKQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVIAGGKYTTYRVMAKDAVDEAVHGLDLRVADCVTEDVPLLGAEGYRAM
WNARARIAARAGLHVVRVEHLLNRYGSMAEEVLALIADDPSLGAPLHCADDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDEGQIEREVEHYEKRV
EAERESQLQPDDLTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactggggccggcgcagcgcgccgagtcgctcgcggcgatggccgag
cgggaactggacgtactcgtcgtgggcgcgggggtggtcggcgcgggcaccgccctcgac
gccgccacccggggcctggccaccggcctggtcgaggcgcgggactgggcgtcgggcacc
tccagccggtccagcaagctcatccacggcggcctgcgctatctggagatgctcgacttc
gccctcgtccgggaggcgctcaaggagcgcggcctgctgctggaacggctcgcgccgcac
ctggtcaagccggtgccgttcctgtatccgctccggcacaagggctgggagcggctgtac
gccggttcgggcgtcgcgctctacgacgcgatgtcgatggcccgcgggcacggccgcggg
ctgcccctgcaccgtcacctgacccggcgtcacgccctgcgggtggcgccctgcttgaag
aaggacgcgctggtcggcgcgctccagtactacgacgcccagatggacgacgcccggttc
gtggcgaccctcgtccgcaccgcggcggcgtacggcgcgctgaccgccaaccgcgcccgc
gtgaccgggttcctgcgcgagggcgagcgggtcgtcggcgcccgggtgcaggacgtcgag
gcgggcggcgagtacgagatccgcgccaagcaggtcgtcaacgccaccggcgtgtggacc
gacgacacccaggcgatggtgggggagcgcgggcagttccacgtccgggcctccaagggc
atccatctggtcgtccccaaggaccgcatccactccacgaccgggctgatcctgcgcacc
gagaagtcggtgctcttcgtcatcccctggggccggcactggatcgtcggcaccaccgac
accgactgggacctggacaaggcccacccggccgcgtccagcgcggacatcgactatctg
ctcgaacacgtgaactcggtcctcgccgtgccgctgacccgcgacgacgtcgagggcgtg
tacgcgggcctgcgcccgctgctggccggcgagtcggacgccaccagcaagctgtcgcgc
gagcacaccgtggcccatcccgtgccggggctggtcgtcatcgcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtggacgaggcggtgcacgggctggacctgcgg
gtcgccgactgcgtcaccgaggacgtcccgctgctcggcgccgagggctaccgggccatg
tggaacgcccgcgcgcgcatcgccgcccgcgcaggactccacgtcgtgcgcgtggagcac
ctgctcaaccgctacggctcgatggccgaggaggtgctggccctcatcgccgacgacccc
tccctgggcgcgccgctccactgcgccgacgactacctgcgcgccgagatcgtctacgcc
gcctcgcacgagggcgcccgccacctggacgacgtgctgacccgccgcacccgcatctcc
atcgagaccttcgaccggggcacccgcagcgcccgcgaggccgccgagctgatggcgccg
gtgctgggctgggacgagggccagatcgaacgggaggtcgagcactacgagaagcgggtg
gaggccgagcgggagtcgcagctccagccggacgacctgacggcggacgcggcacggctc
ggggcgccggacatcgtgccgctgtag

DBGET integrated database retrieval system