KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_02482Help
Entry
SLGD_02482        CDS       T01177                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Brite
KEGG Orthology (KO) [BR:slg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SLGD_02482
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SLGD_02482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored Thi4 AlaDh_PNT_C FAD_binding_2 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ADC88546
LinkDB All DBs
Position
2562261..2563784
Genome map
AA seq 507 aa AA seqDB search
MLNKDLKQQLSQLLDLMEGDVQFVASIGSDDKSKELKDLLDEISGMSERITVVEKDLKRT
PSFSVNRPNEETGITFAGIPLGHEFNSLVLAILQVSGRAPKEKESIINQIKALDGSYHFE
TYVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAIFRDESENIMAVPAVFLDGEEFGNG
RMTISDILSKLGSTQDASEYENKDPYDVLIIGGGPASGSAAIYTARKGLRTGIIADRIGG
QVNDTAGIENFITVKQTTGSEFSSNLADHIAQYDIDAMTGIRATNIEKTDSAIRVTLENN
AVLETKTAIISTGASWRKLNVPGEDRLINKGVAFCPHCDGPLFENKNVAVIGGGNSGVEA
AIDLAGIVKHVTLFEFAPELKADTVLQERLRSLSNVDITTNARTTEVLGDDHVTGIQYED
MSTNEIKELTLDGIFVQIGLVPNTAWLGNAVELNERKEIVTDRNNQTNVPGIFAAGDVTD
QKNKQIIISMGSGANAALNAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacaaagatttaaaacaacaattgtctcaacttcttgacttaatggaaggcgat
gttcaatttgtagcgagcattggttccgacgataaatccaaagaattaaaagatctctta
gatgagatttcaggcatgtcagagcgtataacagtcgttgaaaaagacttaaaacgtaca
ccaagtttttcagtcaatcgtcctaatgaagaaaccggcattacctttgccggtattcca
ttaggccacgaattcaattcactagtcttggctatcttacaagtaagtggtcgtgctcct
aaagaaaaagaaagcattattaatcaaatcaaagcactagatggtagctatcactttgaa
acttatgttagtttaacgtgtcaaaaatgcccagatgtcgttcaagcattaaacttaatg
agtgtaattaaccctaacattacgcatacgatgattgatggtgcgattttccgcgatgaa
tctgaaaatatcatggctgtgcccgctgttttcctagacggtgaagagtttggcaatggt
cgcatgacaatttcagatattttatctaaactaggtagcacacaagatgcttctgaatat
gaaaataaagacccttatgatgtacttatcataggtggtggaccagcaagtggtagtgcg
gctatttacacagcccgcaaaggcctacgcactggaattatcgctgaccgtattggtggt
caagttaatgatacagctggcattgaaaactttattacagttaaacaaacgactggtagt
gagttttcatctaatttagcagatcatattgcgcaatatgacattgatgctatgacaggt
attcgtgccacaaatatcgaaaaaacagattcagctattcgtgttacactcgaaaataat
gcagtattggaaacaaaaactgcgattatttcaacgggcgcaagttggcgtaaactcaat
gttcctggagaagatcgcctaatcaataaaggtgtggcattctgcccgcactgtgacggt
ccactttttgaaaataaaaatgtggcagttatcggtggtggtaattcaggtgttgaagca
gccattgatttagctggtatagtaaaacacgttacattatttgaatttgcaccagagctt
aaagcagatactgtgttacaagaacgtcttcgttcattatctaatgttgatattacaaca
aatgctagaacaacagaagttcttggtgatgatcatgtgactggtatccaatatgaagat
atgtcaactaatgaaattaaagaattaactttagatggtatctttgttcaaattggatta
gttcctaatacagcatggttaggaaatgcagttgagcttaatgaacgtaaagaaattgtg
actgaccgcaataatcaaactaacgttcctggtatctttgctgcaggagatgtaacagat
caaaaaaataaacaaattattatctctatgggatcaggtgctaatgctgcattaaacgca
tttgattatctcatccgaaattaa

DBGET integrated database retrieval system