KEGG   Spirosoma linguale: Slin_4509Help
Entry
Slin_4509         CDS       T01156                                 

Definition
(GenBank) alcohol dehydrogenase zinc-binding domain-containing protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ThiF TrkA_N
Motif
Other DBs
NCBI-GeneID: 8728273
NCBI-ProteinID: ADB40489
UniProt: D2QMS6
LinkDB All DBs
Position
complement(5467631..5468662)
Genome map
AA seq 343 aa AA seqDB search
MKALVLTEYNHFDLQEVPKPSIRPNEVLVRVQAVGICGSDVHGMDGSSGRRIPPIVMGHE
ASGIIAEVGSDVKNWATGDRVTFDSTVYVLDDWYSRRGQYNLSDGREVVGVSTPDFKRNG
AFAEYVAIPQHILYAVPDNVSFTQAALVEPVAVALHAVSLTPIQVNDSAVVVGSGMIGLF
VIQVLKLAGCGTIIAIDLDDDRLALAQKLGATHSINAKSGDVAKQVQDLTHGRGADVSFE
VVGAGPTVKTAIDCVRKGATVTLVGNLAPTVEMPLQAIVTRQLRLQGSCAINGEYEAALA
LISSGRMNVEAILSAEVPLEEGADWFKRLYEKEKGLIKVVLKP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactcgttcttacagaatacaatcactttgacttacaggaagtccccaagcct
tctatccgtcccaacgaagtgctggtgcgcgtgcaggccgtgggtatctgcggctccgat
gtgcacggcatggatggcagcagcggccgacgcattccgcccatcgtgatgggccacgaa
gccagcggcatcattgccgaagtgggcagcgacgtaaaaaactgggctaccggcgaccgc
gtcaccttcgattcgacggtgtacgtgctcgacgactggtacagccgccgggggcagtac
aacctgagcgacggccgcgaagtcgtgggcgtttcgacgcccgattttaagcgtaatggt
gcctttgccgagtatgtagccataccacagcatattttatacgccgttcctgataacgtt
agctttactcaggccgcgcttgtggagccggtggccgtggcactccacgccgttagtctg
acgcccattcaggtcaacgattcggcggtggtagttgggtcgggtatgattggcctgttc
gtaattcaggtgctgaaactggcgggttgcggaacgatcatcgccattgacctggacgac
gaccggctcgcattagctcaaaaacttggcgctacacacagcataaacgcgaaaagtggc
gacgtagccaaacaggtacaggatctgacgcacggtcgcggtgccgatgtttcctttgaa
gtcgtaggagccggaccaaccgtgaaaaccgccatcgactgtgttcggaaaggagccacg
gtcacgctggtcggaaatctggcgccaaccgtcgagatgcctttgcaggctattgtgact
cgtcagcttcggctacagggctcctgcgccatcaacggcgagtacgaagcggcactggcc
ctgatctcgtccgggcggatgaacgttgaagccattctgagtgccgaagtgccgctggaa
gaaggcgccgactggttcaagcggctttatgaaaaagagaaaggactgataaaagtggtg
ctgaaaccttaa

DBGET integrated database retrieval system