KEGG   Spirosoma linguale: Slin_4509
Entry
Slin_4509         CDS       T01156                                 

Definition
(GenBank) alcohol dehydrogenase zinc-binding domain-containing protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sli  Spirosoma linguale
Pathway
sli00040  Pentose and glucuronate interconversions
sli00051  Fructose and mannose metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Slin_4509
   00051 Fructose and mannose metabolism
    Slin_4509
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Slin_4509
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ThiF UDPG_MGDP_dh_N TrkA_N Methyltransf_3
Other DBs
NCBI-GeneID: 8728273
NCBI-ProteinID: ADB40489
UniProt: D2QMS6
LinkDB
Position
complement(5467631..5468662)
AA seq 343 aa
MKALVLTEYNHFDLQEVPKPSIRPNEVLVRVQAVGICGSDVHGMDGSSGRRIPPIVMGHE
ASGIIAEVGSDVKNWATGDRVTFDSTVYVLDDWYSRRGQYNLSDGREVVGVSTPDFKRNG
AFAEYVAIPQHILYAVPDNVSFTQAALVEPVAVALHAVSLTPIQVNDSAVVVGSGMIGLF
VIQVLKLAGCGTIIAIDLDDDRLALAQKLGATHSINAKSGDVAKQVQDLTHGRGADVSFE
VVGAGPTVKTAIDCVRKGATVTLVGNLAPTVEMPLQAIVTRQLRLQGSCAINGEYEAALA
LISSGRMNVEAILSAEVPLEEGADWFKRLYEKEKGLIKVVLKP
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaagcactcgttcttacagaatacaatcactttgacttacaggaagtccccaagcct
tctatccgtcccaacgaagtgctggtgcgcgtgcaggccgtgggtatctgcggctccgat
gtgcacggcatggatggcagcagcggccgacgcattccgcccatcgtgatgggccacgaa
gccagcggcatcattgccgaagtgggcagcgacgtaaaaaactgggctaccggcgaccgc
gtcaccttcgattcgacggtgtacgtgctcgacgactggtacagccgccgggggcagtac
aacctgagcgacggccgcgaagtcgtgggcgtttcgacgcccgattttaagcgtaatggt
gcctttgccgagtatgtagccataccacagcatattttatacgccgttcctgataacgtt
agctttactcaggccgcgcttgtggagccggtggccgtggcactccacgccgttagtctg
acgcccattcaggtcaacgattcggcggtggtagttgggtcgggtatgattggcctgttc
gtaattcaggtgctgaaactggcgggttgcggaacgatcatcgccattgacctggacgac
gaccggctcgcattagctcaaaaacttggcgctacacacagcataaacgcgaaaagtggc
gacgtagccaaacaggtacaggatctgacgcacggtcgcggtgccgatgtttcctttgaa
gtcgtaggagccggaccaaccgtgaaaaccgccatcgactgtgttcggaaaggagccacg
gtcacgctggtcggaaatctggcgccaaccgtcgagatgcctttgcaggctattgtgact
cgtcagcttcggctacagggctcctgcgccatcaacggcgagtacgaagcggcactggcc
ctgatctcgtccgggcggatgaacgttgaagccattctgagtgccgaagtgccgctggaa
gaaggcgccgactggttcaagcggctttatgaaaaagagaaaggactgataaaagtggtg
ctgaaaccttaa

DBGET integrated database retrieval system