Stenotrophomonas sp. LM091: BIZ42_04250 Help Entry BIZ42_04250       CDS       T04630                                  Name (GenBank) hypothetical protein   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism slm  Stenotrophomonas sp. LM091 Brite KEGG Orthology (KO) [BR:slm00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BIZ42_04250 Enzymes [BR:slm01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      BIZ42_04250   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      BIZ42_04250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_9 Fer4_16 Fer4_2 Fer4_10 Fer4_6 Fer4_4 Fer4_22 Fer4_3 Fer4_8 Fer4_17 DUF5651 Fer4_18 Motif Other DBs NCBI-ProteinID:  AOX61467 UniProt:  A0A1D8Y7A8 LinkDB All DBs Position 953730..954047 Genome browser AA seq 105 aa AA seqDB search MARGEAGVDHCPPGGDAGARALADVLGVVALPFDRSRGEHKAPQVAVVIEADCIGCTKCI QACPVDAIVGGAKYMHTVIADLCTGCELCIPPCPVDCIALVSVTR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcacgcggcgaggcgggcgtcgatcattgcccgccaggcggcgatgccggcgcacgc gcgttggcggatgtgctgggggtcgtcgcgctgccgttcgaccgctcgcgcggcgaacac aaggcaccgcaggtcgcggtggtgatcgaagcggactgcatcggctgcaccaagtgcatc caggcgtgcccggtcgatgcgatcgtcggcggtgccaagtacatgcacacggtcatcgcc gatctgtgcaccggctgcgaactgtgcatcccgccgtgcccggtggactgcatcgcactg gtcagcgtaacgcggtag

DBGET integrated database retrieval system