KEGG   Streptomyces lincolnensis: SLINC_4748Help
Entry
SLINC_4748        CDS       T04801                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00250  Alanine, aspartate and glutamate metabolism
sls00410  beta-Alanine metabolism
sls00430  Taurine and hypotaurine metabolism
sls00650  Butanoate metabolism
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
sls01120  Microbial metabolism in diverse environments
sls02024  Quorum sensing
Module
sls_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLINC_4748
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLINC_4748
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLINC_4748
   00430 Taurine and hypotaurine metabolism
    SLINC_4748
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SLINC_4748
Enzymes [BR:sls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SLINC_4748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANS66972
UniProt: A0A1B1MEZ6
LinkDB All DBs
Position
complement(5676710..5678122)
Genome map
AA seq 470 aa AA seqDB search
MPLHQGPEQPDERPLSVNPFYGEADPVGGMAEAPPKHRLPAAPLPPSTAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMDECRDKNMIDKDEYPRTAELERRCVAMLADLWHAPDP
SAAVGCSTTGSSEACMLAGMALKRRWARRNADRYPSRDVRPNLVMGVNVQVCWEKFCTFW
EVEARQVPMEGDRFHLDAQAAAELCDENTIGVVGILGSTFDGSYEPVAELCAALDALQER
TGLDIPVHVDGASGAMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDQE
ALPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQSTRDVARGL
AARVEALGDFRLLTRGDELPVFAFTTAPGVEAYDVFDVSRRMRERGWLVPAYTFPPNRED
LSVLRVVCRNGFSADLAELFVEDLGRLVPELRRQPHPLTRDKEAATGFHH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcaccaagggccggagcagcccgacgagcgcccgttgtccgtcaatcccttc
tacggcgaggccgacccggtcggcggaatggccgaggccccgcccaagcaccggctcccc
gccgctcccctgccgccgtcgaccgcctatcagctggtgcacgacgagctgatgctggac
ggcaactcccggctgaatctcgccaccttcgtcaccacctggatggaaccgcaggccggg
gtcctgatggatgagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgagctggagcggcgctgcgtggccatgctcgccgacctgtggcacgcgcccgatccc
tcggcggccgtgggctgttcgacgaccggctccagcgaggcctgcatgctcgccgggatg
gcgctcaagcggcgctgggcgcgtcgcaatgccgaccggtacccctccagggacgtccgc
ccgaatctcgtcatgggtgtcaacgtccaggtctgctgggagaagttctgcaccttctgg
gaggtggaggcccggcaggttcccatggagggcgaccgcttccacctcgacgcccaggcc
gcggccgagctgtgcgacgagaacaccatcggggtcgtgggcatcctcggctccaccttc
gacgggtcctacgagccggtcgccgagctgtgcgctgccctggacgccctccaggaacgc
accggcctcgacatcccggtgcatgtcgacggggcgtccggcgcgatggtcgcgcccttc
ctcgacgaggacctggtgtgggacttccggctgccgcgcgtggcctcgatcaacacctcc
gggcacaagtacgggctggtctacccgggcgtcggctgggcgctgtggcgtgatcaggag
gcgctgcccgaggagctcgtcttccgcgtcaactacctgggcggcgacatgccgaccttc
gcgctgaacttctcccggccgggcgcccaggtcgtcgcgcagtactacacgttcctccgg
ctgggccgcgagggctaccgggccgtgcagcagtccacgcgggacgtggcccgggggctc
gccgcacgggtggaggcgctcggcgacttccggctgctgacccggggcgacgagctgccg
gtcttcgccttcacgaccgcgcccggggtggaggcgtacgacgtcttcgacgtgtcccgg
cggatgcgggagcggggctggctggtgcccgcgtacaccttcccgccgaaccgggaggac
ctgtccgtcctgcgggtggtgtgccgcaacggcttctccgccgacctcgccgaactgttc
gtggaggacctgggccgcctggtgcccgagctgcgccggcaaccgcacccgctgacccgg
gacaaggaggcggccaccggcttccaccactga

DBGET integrated database retrieval system