KEGG   Streptomyces lincolnensis: SLINC_5139Help
Entry
SLINC_5139        CDS       T04801                                 

Definition
(GenBank) glycerol phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00564  Glycerophospholipid metabolism
sls01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SLINC_5139
Enzymes [BR:sls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SLINC_5139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8 DUF5069
Motif
Other DBs
NCBI-ProteinID: ANS67363
UniProt: A0A1B1MFS1
LinkDB All DBs
Position
6110370..6112025
Genome map
AA seq 551 aa AA seqDB search
MAERELDVLVVGAGVVGAGTALDAVTRGLSVGLVEARDWASGTSSRSSKLVHGGLRYLEM
LDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLYAGSGVALYDAMSMARGH
GRGLPVHRHLSRRHALRVAPALKKDALVGALQYYDAQMDDARFVATLVRTAAAYGAKTAN
RARVTGFLREGERVVGARVQDVEAGGEYEIRAKQVVNATGVWTDDTQAMVGERGQFHVRA
SKGIHLVVPKDRITSSSGLILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADI
DYLLEHVNSVLAVPLTRDDVQGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDEAVHGLDMRVAECVTEDVPLLGAEGYRALWNARARIAARTGLHVVR
VEHLLNRYGALAEEVLDLVAADTSLGEPLHAADDYLRAEIVYAASHEGARHLDDVLTRRT
RISIETFDRGTRSAREAAELMAPVLGWDKDQIEREVEHYEKRVEAERESQRQPDDLTADA
ARLGAPDIVPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgtgagctggacgtgctggtggtgggagcgggtgtggtcggcgcgggcacc
gccctcgacgccgtcacccgagggctgtccgtgggcctggtcgaggcgcgtgactgggcg
tccggcacctccagccgctccagcaaactggtccacggcggcctgcgctatctggagatg
ctcgacttcgcgctcgtccgcgaggcgctgaaggagcgcggcctgctgctggagcggctc
gcgcctcatctggtgaagcccgtgccgttcctgtacccccttcagcacaagggctgggag
cggttgtacgccggctcgggcgtcgcgctctacgacgccatgtcgatggcccgcggccac
ggccggggcctgcccgtgcaccgccatctgagccgccgtcacgccctgcgggtcgcgccc
gctctgaagaaggacgcgctggtcggggcgttgcagtactacgacgcccagatggacgac
gcccgcttcgtggcgaccctcgtgcgcaccgcggcggcctacggcgccaagaccgccaac
cgcgcgcgggtcaccggcttcctgcgcgagggggagcgggtcgtcggcgcccgggtgcag
gacgtcgaggccggcggggagtacgagatccgcgccaagcaggtcgtcaacgcgaccggt
gtgtggaccgacgacacccaggcgatggtcggggagcgcggccagttccacgtccgggcg
tccaagggcatccacctcgtcgtccccaaggaccgcatcacctcctcgtccggcctgatc
ctgcgcaccgagaagtccgtcctcttcgtcatcccctggggccggcactggatcatcggg
acgacggacaccgactgggacctggacaaggcgcacccggccgcgtccagcgccgacatc
gactatctgctggagcacgtgaactccgtgctcgcggtgccgctgacccgcgacgacgtc
cagggcgtgtacgcgggactgcggccgctgctcgccggtgagtcggacgccaccagcaag
ctctcgcgcgaacacaccgtggcgcatccggtgccggggctcgtggtcgtggcgggcggc
aagtacacgacctaccgggtgatggccaaggacgcggtggacgaggcggtgcacggcctc
gacatgcgggtcgccgagtgcgtcacggaggacgtgccgctgctgggcgccgaggggtac
cgggcgctgtggaacgcgcgggcgcggatcgccgcgcggaccggtctgcacgtggtgcgc
gtcgagcatctgctgaatcggtacggcgcgctggcggaggaggtcctcgacctcgtcgcc
gcggacacctcgctcggcgagccgctgcacgccgccgacgactatctgcgcgccgagatc
gtctacgccgcctcccacgagggggcgcggcatctggacgacgtcctgacccggcgcacc
cgtatctccatcgagaccttcgaccggggcacccgcagcgcccgcgaggccgccgagctg
atggcgccggtgctcggctgggacaaggaccagatcgaacgcgaggtcgagcactacgag
aagcgggtcgaggcggagcgggagtcgcaacgacagccggacgacctgacggcggacgcg
gcgcggttgggggcgccggacatcgtgccgctctag

DBGET integrated database retrieval system