KEGG   Streptomyces lividans: SLIV_14490Help
Entry
SLIV_14490        CDS       T03222                                 

Gene name
glpD2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
slv  Streptomyces lividans
Pathway
slv00564  Glycerophospholipid metabolism
slv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SLIV_14490 (glpD2)
Enzymes [BR:slv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SLIV_14490 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIJ13882
UniProt: D6EDY7
LinkDB All DBs
Position
complement(3302863..3304569)
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAQRAESLAAMAERELDVLVVGAGVVGAGTALDAVTRGLSVGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFVLVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLSRRHALRVAPALKKDALVGALQYYDAQMDDARF
VATLVRTAAAYGAKVANRARVTSFLREGERVVGARVQDVEAGGEYEVRAKQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLSVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDLRVADCVTEETPLLGAEGYHAQ
WNARARIAARTGLHVVRVEHLLNRYGSLTEELLELVAADPSLGEPLTGADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCAREAAELMAPVLGWDKGQVEREIEHYEKRV
EAERESQRQPDDLTADAARLGAPDIAAR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacccttgggccggcgcagcgcgccgagtcactcgcggccatggccgag
cgcgaactcgacgtactggtggtgggcgccggcgtggtcggtgcgggcaccgccctcgac
gccgtgacgcgcggcctgtccgtcggcctggtcgaggcgcgggactgggcctcgggcacc
tccagcaggtccagcaagctgatccacggcggcctgcgctatctggagatgctcgacttc
gtgctcgtgcgggaggcgctgaaggagcgcggactgctgctggaacggctggcgccgcac
ctggtgaagccggtgccgttcctgtacccgctccagcacaagggctgggagcggctgtat
gccggatcgggcgtcgcgctctacgacgccatgtccatggcccgcgggcacgggcggggc
ctgccgctgcaccggcacctgagccgccgtcacgccctgcgcgtggcgcccgcgctgaag
aaggacgcgctggtcggcgcgttgcagtactacgacgcccagatggacgacgcccgcttc
gtagccacgctggtgcgcaccgcggcggcgtacggcgccaaggtcgccaaccgcgcccgg
gtcacctccttcctgcgcgagggcgaacgggtggtcggcgcccgggtgcaggacgtcgag
gcgggcggcgagtacgaggtccgcgccaagcaggtggtgaacgcgaccggggtgtggacc
gacgacacccaggcgatggtcggcgagcgcggccagttccacgtccgggcctccaagggc
atccacctggtcgtgcccaaggaccgcatccactccagcaccgggctgatcctgcgcacc
gagaaatccgtgctgttcgtcatcccctggggccggcactggatcatcggcaccacggac
accgactgggacctggacaaggcccacccggccgcgtccagcgccgacatcgactacctg
ctggaacacgtcaactcggtgctgtcggtgcccctcacgcgcgacgacgtcgagggcgtg
tacgccggactgcgcccgctgctggccggcgagtcggacgccaccagcaagctgtcgcgc
gagcacaccgtcgcccacccggtgcccggcctggtcgtcgtggccggcgggaagtacacg
acgtaccgggtgatggccaaggacgccgtcgacgaggccgtgcacgggctcgacctgcgg
gtcgccgactgcgtcaccgaggagacgccgctgctcggcgccgagggctaccacgcgcag
tggaacgcccgggcccggatcgccgcccgcaccggactgcacgtcgtacgcgtcgagcat
ctgctcaaccgctacggctcgctgacggaggaactgctcgaactcgtcgccgccgacccc
tccctgggcgagccgctcaccggcgccgacgactacctgcgcgccgaagtcgtctacgcc
gcctcgcacgagggcgcccggcacctggacgacgtactgacccggcgcacccgtatctcc
atcgagaccttcgaccggggcacgcgctgcgcccgcgaggccgccgagctgatggcaccg
gtcctcggctgggacaagggccaggtcgagcgggagatcgagcactacgagaagcgggtc
gaggccgagcgggagtcccagcgccagcccgacgacctgacggccgacgcggcccggctg
ggggcgccggacatcgcggcgcggtga

DBGET integrated database retrieval system