KEGG   Streptomyces lividans: SLIV_20690Help
Entry
SLIV_20690        CDS       T03222                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
slv  Streptomyces lividans
Pathway
slv00250  Alanine, aspartate and glutamate metabolism
slv00410  beta-Alanine metabolism
slv00430  Taurine and hypotaurine metabolism
slv00650  Butanoate metabolism
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
slv01120  Microbial metabolism in diverse environments
slv02024  Quorum sensing
Module
slv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLIV_20690
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLIV_20690
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLIV_20690
   00430 Taurine and hypotaurine metabolism
    SLIV_20690
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SLIV_20690
Enzymes [BR:slv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SLIV_20690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIJ15081
UniProt: A0A076M470
LinkDB All DBs
Position
complement(4573256..4574683)
Genome map
AA seq 475 aa AA seqDB search
MSLHQGPRPSRDSDRDRRRLAVNPFHAAANPLGGMTEAPPAHRLPDSPLPPESAYRLVHD
ELMLDGNARLNLATFVTTWMEPQAGVLMSECRDKNMIDKDEYPRTAELERRCVAMLADLW
HAPDPSTAVGCSTTGSSEACMLAGMALKRRWALRNADRYPAKDVRPNLVMGVNVQVCWDK
FCNFWEVEARQVPMEGDRFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVADLCAALD
ALQERTGLDVPVHVDGASGAMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWAL
WRDAEALPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYNFLRLGREGYRAVQQSARD
IAGSLAERVAALGDFRLLTRGDQLPVFAFTTADDVTAYDVFDVSRRLREGGWLVPAYTFP
PHREDLSVLRVVCRNGFSADMADLLLADLERLLPELRRQPGPLTRDKGAATGFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaccagggcccgcgcccgtcccgcgacagcgatcgtgaccggcgccggctc
gccgtgaaccccttccacgcggcggcgaacccgctcggcggcatgaccgaggccccgccc
gcccaccggctgcccgactccccgctgccaccggagagcgcgtaccgcctggtccacgac
gagctgatgctggacggcaacgcgcggctgaacctggccaccttcgtcaccacctggatg
gagccgcaggccggggtgctgatgagtgagtgccgtgacaagaacatgatcgacaaggac
gagtacccgcgcaccgccgaactggagcggcgttgcgtggccatgctcgccgacctgtgg
cacgcgcccgacccgtcgaccgcggtgggctgctcgacgaccgggtcgagcgaggcgtgc
atgctggccgggatggcgctgaagcggcgctgggcactgcgcaacgccgaccggtacccg
gcgaaggacgtgcggcccaatctggtgatgggcgtcaacgtccaggtctgctgggacaag
ttctgcaacttctgggaggtggaggcccggcaggtcccgatggagggcgaccgcttccac
ctggacccgcaggccgccgccgagctgtgcgacgagaacacgatcggggtcgtcggcatc
ctgggctccaccttcgacggctcctacgaaccggtcgccgacctgtgcgcggccctggac
gccctccaggagcggaccggactcgacgtcccggtgcacgtcgacggggcctcgggcgcc
atggtcgcgcccttcctggacgaggacctggtgtgggacttccggctgccccgggtcgcc
tcgatcaacacctcggggcacaagtacgggctggtctaccccggggtcggctgggcgctg
tggcgggacgcggaggcccttcccgaggaactggtcttccgggtcaactacctgggcggc
gacatgccgaccttcgcgctgaacttctcccggccgggcgcgcaggtcgtcgcgcagtac
tacaacttcctgcggcttggccgtgagggctaccgggccgtgcagcagtccgcgcgggac
atcgcgggctcgctcgcggaacgggtggcggcactcggcgacttccggctgctgacgcgc
ggcgaccagttgcccgtgttcgccttcacgacggccgacgacgtgacggcgtacgacgtc
ttcgacgtgtcccggcggctgcgggagggcggctggctggtgccggcgtacaccttcccg
ccgcaccgcgaggacctctccgtgctgcgggtggtgtgccgcaacggcttctcggccgac
atggccgacctgctgctcgcggacctggagcgcctgctcccggaactgcggcgccagccg
ggcccgctgacccgcgacaagggggcggcgacggggttccatcactga

DBGET integrated database retrieval system