KEGG   Streptomyces lividans: SLIV_28495Help
Entry
SLIV_28495        CDS       T03222                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
slv  Streptomyces lividans
Pathway
slv00051  Fructose and mannose metabolism
slv01100  Metabolic pathways
slv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SLIV_28495
Enzymes [BR:slv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SLIV_28495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIJ16607
UniProt: D6ELH7
LinkDB All DBs
Position
6368840..6369562
Genome map
AA seq 240 aa AA seqDB search
MTYSRAGGAEGAGEPDREAAGDPTAGPAREAAWAELVATARRTVADGLVVGTSGNVSVRV
GDTVLVTPSGVPYDRLTPDDATGVDLDGRQVLGTLVPTSELPMHLAVYRADPGARAVVHT
HAVHATAVSLLVPELPPVHYMTAALGGPVRVAPYAAYGTAELARGMLDALAGRTGCLLRN
HGTITYGTSLDQAYDRTAQLEWMCRLWLTASSVPGHSPSLLTPAQLAEVTERLRGYGQRS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtattcgcgggccggaggggcggaaggggccggggagccggaccgggaagcggcc
ggggatccgaccgcggggccggcccgggaagcggcctgggcggaactcgtcgcgacggcc
cggcggacggtcgccgacggactggtggtgggcacctccggcaacgtctcggtgcgcgtc
ggcgacacggtcctggtcaccccgtcgggcgtcccctacgaccggctgaccccggacgac
gcgaccggcgtcgacctggacggacggcaggtgctcggcaccctcgtccccaccagcgaa
ctgcccatgcacctcgccgtgtaccgcgccgaccccggcgcccgggccgtcgtccacacc
cacgccgtgcacgcgacggcggtctcgctgctcgtccccgaactcccgccggtgcactac
atgaccgccgccctcggcggccccgtccgggtcgccccctacgcggcctacggcaccgcc
gaactcgcccgcggcatgctcgacgccctcgccggccgcaccggctgcctgctccgcaac
cacggcacgatcacctacggcacctccctcgaccaggcctacgaccgcaccgcccagctc
gagtggatgtgccgcctgtggctgaccgcgtcctcggtgcccggccactcgccgtccctg
ctgacgccggcccagctcgccgaggtgaccgaacgcctccgggggtacgggcagcgaagc
tga

DBGET integrated database retrieval system