KEGG   Streptomyces lavendulae: SLAV_15555Help
Entry
SLAV_15555        CDS       T05314                                 

Gene name
glpD1
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
slx  Streptomyces lavendulae
Pathway
slx00564  Glycerophospholipid metabolism
slx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SLAV_15555 (glpD1)
Enzymes [BR:slx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SLAV_15555 (glpD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATZ24965
UniProt: A0A2K8PH59
LinkDB All DBs
Position
complement(3624310..3626016)
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAQRAEALARMAERELDVLVVGAGVVGAGTALDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKAWERFY
AGSGVALYDAMSFSSGHGRGLPTHRHLSRRRALRIAPALRKDALVGALQYYDAQMDDARY
VATLVRTSAAYGAHCANRARVVGFLREGERVVGARVQDVEGGGEYEIRAQQVVNATGVWT
DDTQALIGERGMFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAVPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDRRVAECVTEDVPLVGAEGYRAL
WNARARTAARTGLHVVRVEHLLNRYGSLTEEILELIAADPSLGEALTGADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSARECAELMAPVLGWDKQQIEKEVEHYEKRV
QAERESQRQPDDQTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggaccggcgcagcgcgcggaggcgctcgcccggatggccgag
cgggaactggacgtgctggtcgtcggtgcgggggtggtcggcgccggcacggcgctggac
gcggtcacccggggcctgtcgacgggtctggtggaggccagggactgggcgtccggcacg
tcgagccggtcgagcaagctcattcacggcgggctcaggtacctggagatgctcgacttc
gcgctcgtgcgcgaggcgctgaaggagcgcggcctgctgctggagcgcctcgccccgcac
ctggtgaagccggtgccgttcctgtacccgctccagcacaaggcctgggagcgtttctac
gccggttcgggcgtggccctctacgacgccatgtccttctccagcgggcacgggcgcggc
ctgcccacccaccggcacctctcgcgccgcagggcgctgcggatcgccccggccctgcgc
aaggacgcgctcgtgggcgccctgcagtactacgacgcccagatggacgacgcgcgctac
gtcgccaccctcgtgcggacgtccgccgcgtacggggcgcactgcgccaaccgggcgagg
gtggtcggcttcctgcgcgagggcgaacgggtggtgggcgcccgggtccaggacgtggag
ggcggcggggagtacgagatccgcgcccagcaggtggtcaacgcgaccggggtgtggacc
gacgacacccaggcgctcatcggcgagcgcgggatgttccacgtccgggcgtcgaagggg
atccacctggtcgtcccgaaggaccgcatccattcgagcaccgggctgatcctgcggacg
gagaagtcggtgctgttcgtcatcccgtggggccgccactggatcgtgggcaccaccgac
accgactgggacctggacaaggcccacccggccgcttcgagcgcggacatcgactacctg
ctggaacacgtgaactcggtgctggcggtgccgctgacccgggacgacgtccagggggtc
tacgcgggcctgcggccgctgctggccggggagtcggacgcgacgagcaagctctcgcgc
gagcacaccgtggcccatcccgtgccgggactggtggtggtggccggcggcaagtacacg
acgtaccgggtgatggccaaggacgcggtcgacgaggcggtgcacgggctcgaccggcgg
gtggcggagtgcgtcacggaggacgtgccgctggtgggggccgaggggtaccgggccctg
tggaacgcccgcgcgcggacggcggcgcgtacggggctccatgtggtgcgggtggagcac
ctgttgaaccggtacggatccctgacggaggagatcctcgaactgatcgcggccgacccg
agcctgggcgaggcgctgaccggggcggacgactacctgcgggccgaggtcgtctacgcc
gcctcgcacgagggggcccggcacctggacgacgtcctgacgcggcggacccggatctcg
atcgagaccttcgaccgggggacccgatcggcccgcgagtgtgcggaattgatggctccg
gttctggggtgggacaagcagcagatcgagaaggaggtcgagcactacgagaagagggtc
caggcggagcgcgaatcccagcgccagccggacgaccagacggcggacgcggcgcggctg
ggggcgccggacatcgttccgttgtaa

DBGET integrated database retrieval system