KEGG   Streptomyces avermitilis: SAVERM_4655Help
Entry
SAVERM_4655       CDS       T00126                                 

Gene name
gadB2
Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00410  beta-Alanine metabolism
sma00430  Taurine and hypotaurine metabolism
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma02024  Quorum sensing
Module
sma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_4655 (gadB2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_4655 (gadB2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_4655 (gadB2)
   00430 Taurine and hypotaurine metabolism
    SAVERM_4655 (gadB2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_4655 (gadB2)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SAVERM_4655 (gadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAC72367
NITE: SAV4655
UniProt: Q82EG0
LinkDB All DBs
Position
complement(5678301..5679713)
Genome map
AA seq 470 aa AA seqDB search
MPLHKGPVKSDERPMSFNPFFGEANPVSGMTEAPPKHRLADGPLPPSTAYQLVHDELMLD
GNARLNLATFVTTWMEPQAGVLMAECQDKNMIDKDEYPRTAELEKRCVAMLADLWNAPDA
GAAVGCSTTGSSEACMLAGLALKRRWARRNADRYPARDVRPNLVMGINVQVCWEKFCNFW
EVEMRQVPLEGERYHLDPGAAAELCDENTIGVVGILGSTFDGSYEPIAELCAALDALQER
TGLDIPVHVDGASGAMIAPFLDEDLVWDFRLPRVASINTSGHKYGLVSPGVGWALWRDSE
ALPEELVFRVNYLGGNMPTFALNFSRPGAQVVAQYYTFLRLGREGFRAVQQTTRNVARSL
AERVAALGDFHLLTRGDELPVFAFTTAPEVASYDVFDVSRRMREHGWLVPAYTFPPNRED
LSVLRVVCRNGFSTDLAELFVEDLSRLLPDLRRQARPQTHDKDAATGFHH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccacaaaggccccgtgaagtccgacgaacgcccgatgtccttcaacccgttc
ttcggggaggccaatccggtcagcgggatgaccgaggccccgcccaagcaccggctcgcg
gacgggccgctgccgccctcgacggcgtaccagctcgtgcacgacgaactgatgctggac
ggcaacgcgcgcctcaacctcgccaccttcgtcaccacctggatggagccgcaggccggg
gtgctgatggcggagtgccaggacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgagctggagaagcggtgcgtggcgatgctcgccgatctgtggaacgcgcccgacgcg
ggggcggccgtgggctgttcgacgaccggttcgagcgaggcgtgcatgctcgccgggctg
gcgctgaagcgccgctgggcgcggcgcaacgcggaccgctaccccgcgagggacgtccgt
ccgaacctcgtcatgggcatcaacgtccaggtctgctgggagaagttctgcaacttctgg
gaggtcgagatgcgccaggtccccttggagggcgagcggtaccacctcgatccgggagcc
gccgccgagctgtgcgacgagaacaccatcggggtcgtcgggatcctcggctccaccttc
gacgggtcgtacgagccgatcgccgaactgtgcgcggccctcgacgccctccaggagcgg
accgggctcgacataccggtgcatgtggacggcgcgtccggcgccatgatcgcgcccttc
ctcgacgaggacctggtctgggacttccggctgccgcgggtcgcgtcgatcaacacgtcc
gggcacaagtacggcctcgtctccccgggcgtcggctgggcgctgtggcgggacagcgag
gcgctgcccgaggaactcgtcttccgcgtcaactacctgggcggcaacatgccgaccttc
gcgctcaacttctcccggccgggagcccaggtcgtcgcgcagtactacaccttcctgcgg
ctcggccgggagggcttccgggccgtgcagcagacgacgcggaacgtggcgcgcagcctc
gccgagcgtgtggcggcgctgggcgacttccatctgctcacccgcggcgacgagttgccc
gtcttcgccttcacgaccgcgccggaggtcgcctcgtacgacgtcttcgacgtgtcccgg
cggatgcgtgagcacggctggctggtgcccgcgtacacgttcccgccgaaccgggaggac
ctgtccgtgctgcgggtggtgtgccgcaacggcttctccaccgacctcgccgaactgttc
gtcgaggacctgagccgcctcctgcccgacctgcgccgccaggcgcgcccacagacccac
gacaaggacgcggcgaccggtttccatcactag

DBGET integrated database retrieval system