KEGG   Serratia sp. FGI94: D781_4034Help
Entry
D781_4034         CDS       T02433                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00250  Alanine, aspartate and glutamate metabolism
smaf00410  beta-Alanine metabolism
smaf00640  Propanoate metabolism
smaf00650  Butanoate metabolism
smaf01100  Metabolic pathways
smaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D781_4034
   00650 Butanoate metabolism
    D781_4034
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D781_4034
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D781_4034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smaf01007]
    D781_4034
Enzymes [BR:smaf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     D781_4034
Amino acid related enzymes [BR:smaf01007]
 Aminotransferase (transaminase)
  Class III
   D781_4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGB84223
UniProt: L0MK05
LinkDB All DBs
Position
complement(4268024..4269289)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQQATPRGVGVMCGFYAERAENATLWDVEGNQVIDFAAGIAVLNTGHRHPK
VLAAIEQQLQAFTHTAYQIVPYESYVSLAERINQRAPIDGPCKTAFFTTGAEAVENAVKI
ARAHTGRPGIITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALHGISTQ
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFIQALRTLCDEHGILLVADEV
QTGFARTGKLFAMEHYDSKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVMDVIDEEQLCQRAQRLGHHLVEVLQQARASCPAIAEIRAQGSMVAVEFND
PASGQPSAEFTRQVQQKALQEGLLLLSCGVHGNVIRFLYPLTIPEEQFTKALGILSRALA
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaaccaacgtcgtcagcaagccacgccacgcggggtgggagtt
atgtgtggtttttacgcagagcgggcggaaaacgccaccctgtgggatgtggaaggcaat
caagttatcgattttgcggccggcatcgcggtgctgaacaccggtcaccgtcatccgaaa
gtgctggcagcgattgagcaacagctgcaggcctttacccataccgcctaccagatcgtg
ccgtatgaaagctacgtctcactggccgagcgcatcaaccagcgcgcgccgatcgacggg
ccgtgtaagaccgccttcttcaccaccggcgccgaagcggtcgaaaacgcggtgaaaatc
gcccgcgctcataccggccgtccgggcattatcacctttggcggcggcttccacggccgc
acctatatgaccatggcgctgaccggcaaagtggcgccgtacaaactgggcttcgggccg
ttccccggctcggtgttccacggccagtacccgaacgcgctgcacggcatcagcacgcag
gacgcgatgaacagcctggagcgcatcttcaaggcggatatcgacccgaaacaggtggcg
gcgatcgtgctggagccggtgcagggcgagggcggctttaacgttgcgccggcggagttt
atccaggcgctgcgcacgctgtgcgatgagcacggcatcctgctggtggcggatgaagta
cagaccggctttgcccgtaccggcaagctgttcgccatggagcattacgacagcaaaccc
gatctgatcaccatggcgaaaagcctggcgggcggcatgccgctgtcggcggtggcgggc
cgcgccgaggtgatggacgcgccggcgccgggcgggctgggcggcacctatgccggtaac
ccgctggcggtggccgcggcgcatgcggtcatggacgtgattgatgaagagcagctgtgc
cagcgcgcgcagcgtctgggtcatcatctggtggaggtgctgcagcaggcgcgcgccagc
tgtccggccatcgccgagatccgcgcgcaggggtcgatggtggcggtcgagtttaacgac
cccgccagcggccagccgtcggcggaattcacccgtcaggtacagcaaaaagccctgcag
gaaggcctgctgctgctgagctgcggcgtacacggcaacgtgatccgcttcctgtacccg
ctgaccattcctgaagaacaattcaccaaggcgctgggcattctttcccgcgcgttggct
gaataa

DBGET integrated database retrieval system