KEGG   Streptomyces malaysiensis: SMALA_4312Help
Entry
SMALA_4312        CDS       T05189                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:smal00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SMALA_4312
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_4312
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smal03016]
    SMALA_4312
   03029 Mitochondrial biogenesis [BR:smal03029]
    SMALA_4312
Enzymes [BR:smal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     SMALA_4312
Amino acid related enzymes [BR:smal01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SMALA_4312
Transfer RNA biogenesis [BR:smal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SMALA_4312
 Prokaryotic type
   Other AARSs
    SMALA_4312
Mitochondrial biogenesis [BR:smal03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SMALA_4312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1 tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ATL84545
UniProt: A0A291SUJ9
LinkDB All DBs
Position
complement(5431229..5432881)
Genome map
AA seq 550 aa AA seqDB search
MLALAKKLKGNPRELASKVVSHLPVAATSADPDPVIEDIEVSGPGFLNITIADSAITATL
AARAADDRLGVPRADSPGTTVIDYAQPNVAKEMHVGHLRSAVIGDAVVRILEFAGEQVVR
RHHIGDWGTQFGMLIQYLIEHPHELDHKDAASGQEAMSNLNRLYKAARALFDSDEEFKER
SRRRVVDLQAGDEETIALWRKFVDESKIYFYSVFDKLDIEIHDPDVVGESGYNDMLAETS
RLLEESGVAVRSEGALCVFFDDVKGPEGKPVPLIVQKSDGGFGYAATDLSAIRDRVQHLK
ADTLLYVVDARQSLHFKMVFETARRIGWLNDQVHAVQLAFGTVLGKDGKPFKTRAGETVR
LEDLLDEATERAAAVVREKSEKLGLTEEEILERGAQVGIGAVKYADLSTSASRDYKFDLD
QMVSLNGDTSVYLQYAYARIQSILRRAGEGQRPLAHPELRLAPAERALGLHLDQFGETLR
EVAAGFEPHKLAGYLYQLASLYTTFYDQCPVLKAEGGPAQVENRLFLCDITARTLRQGMT
LLGIRTPERL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctggccaagaagctcaagggaaacccccgtgagctggcctccaaggtcgtc
tcgcaccttccggtcgccgccacctcggccgaccccgatccggtgatcgaggacatcgag
gtctccggccccggcttcctcaacatcacgatcgccgactccgcgatcaccgcgacgctc
gccgcccgcgccgccgacgaccgcctcggtgtgccgcgcgcggattcgcccggcaccacc
gtgatcgactacgcccagcccaatgtggccaaggagatgcacgtcggccatctgcgctcg
gccgtgatcggcgacgcggtggtgcggatcctggagttcgcgggcgagcaggtggtccgc
cgccaccacatcggcgactggggcacccagttcggcatgctcatccagtatctgatcgag
cacccgcatgagctggaccacaaggacgcggcctccggccaggaggccatgtccaacctc
aaccggctctacaaggccgcgcgggcgctcttcgactccgacgaggagttcaaggagcgg
tcccggcggcgggtggtcgatctccaggcgggcgacgaggaaaccatcgccctgtggcgg
aagttcgtcgacgagtcgaagatctacttctactcggtcttcgacaagctggacatcgag
atccacgaccccgatgtggtcggcgagtcgggttacaacgacatgctggccgagacctcc
cggctgctggaggagtccggcgtcgccgtccgctccgagggtgcgctgtgcgtcttcttc
gacgacgtcaagggccccgagggcaagccggtgccgctgatcgtccagaagtccgacggc
ggcttcggctatgcggccaccgacctctccgcgatccgtgaccgggtgcagcacctgaag
gccgacaccctgctgtatgtggtggacgcccgtcagtcgctgcacttcaagatggtcttc
gagaccgcccgccggatcggctggctcaatgatcaggtgcacgccgttcagctcgccttc
ggcaccgtcctgggcaaggacggcaagccgttcaagacccgcgcgggcgagacggtgcgg
ctcgaggacctgctggacgaggccaccgagcgggccgcggccgtggtccgggagaagagc
gagaagctgggcctcacggaggaggagatcctcgagcgcggcgcccaggtcggcatcggc
gcggtgaagtacgcggatctgtccacctccgcatcgcgcgactacaagttcgacctcgac
cagatggtctcgctcaacggcgacacctcggtctacctccagtacgcgtacgcccggatc
cagtcgatcctgcgccgcgccggggaggggcagcggccgctggcccaccccgagcttcgg
ctggccccggccgagcgggcgctgggcctgcacctcgaccagttcggggagacgctgcgc
gaggtggccgccgggttcgagccgcacaagctggccgggtatctctaccagctggcctcg
ctctacacgaccttctacgaccagtgcccggtcctgaaggcggagggcggcccggcccag
gtggagaaccgcctcttcctatgcgacatcacggcgcggacgctgcggcagggcatgacc
ctgctgggcatccgcacccccgagcgcctctga

DBGET integrated database retrieval system