KEGG   Serratia marcescens SM39: SM39_3891Help
Entry
SM39_3891         CDS       T03592                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smar  Serratia marcescens SM39
Pathway
smar00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SM39_3891
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smar02000]
    SM39_3891
Enzymes [BR:smar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SM39_3891
Transporters [BR:smar02000]
 Other Transporters
  Pores ion channels [TC:1]
   SM39_3891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: BAO35832
LinkDB All DBs
Position
complement(4026706..4027374)
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNHSRSQRILWFLEELGVPYQVQRYERDPQTMLAPVALKKIHPLGKSPVIVDGD
LTLAESGAIIEYLQEAYDAQGMFMPTDFHARQQYRYWLHYAEGSLMPLLVMKLVFSRLGQ
PPIPWLLRPVAGAIGKGVQREYLDKQIAPHCEYLEQHLNKGSWFVGNDFSAADIQMSFPL
EAMAARGALDDCPKLRGFLQRIHARPAYQRALEQGGPYDLLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcattgttcatcatctcaatcattcgcgctcgcagcgcattctgtggtttctggaa
gagctgggcgtgccctatcaggtgcaacgctacgaacgcgatccgcagaccatgctggcg
ccggtggcgctgaaaaagatccacccgctgggcaaatcaccggtgatcgtcgacggcgat
ctgacgctggcggaatccggcgccatcatcgaatacctgcaggaagcctatgacgcgcaa
gggatgttcatgccgaccgacttccacgcgcgccagcaataccgctactggctgcactac
gccgaaggatcgctgatgccgctgttggtgatgaaactggtgttcagccgcctcggccag
ccgccgatcccttggctgctgcggccggtggccggcgcgatcggcaagggcgtgcagcgc
gaatatctcgacaagcagatcgcgccgcactgcgagtatctcgagcagcacttgaacaag
ggcagctggttcgtcggcaacgactttagcgcggcagacattcagatgagcttcccgctg
gaggcgatggcggcgcgcggcgcgttggatgattgcccgaaactgcgcggttttctgcag
cgcattcacgcccggcccgcctaccagcgggcgttggagcaaggcggcccttacgacctg
ctgagttaa

DBGET integrated database retrieval system