KEGG   Sinorhizobium meliloti AK83: Sinme_2798Help
Entry
Sinme_2798        CDS       T01521                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Sinme_2798
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smk03400]
    Sinme_2798
Enzymes [BR:smk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Sinme_2798
DNA repair and recombination proteins [BR:smk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Sinme_2798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AEG54505
LinkDB All DBs
Position
1:2810446..2813043
Genome map
AA seq 865 aa AA seqDB search
MAARNEPLSEYNRRRDFTRTSEPKGAVARRSGDNRMRFLVQKHAATRLHYDFRLEWEGVL
KSWAVTRGPSLNPEDKRLAVRTEDHPLAYGDFEGTIPKGEYGGGTVMLWDTGWWEPEDDP
SKALKKGKLSFKLHGSRMKGGWALVRMRPPEGEKRENWLLVKETDDVASDDGESLINENI
TSIVTGRTMEEIAEGRGEKRARVWHSNKSISANLKAGAIAENGNAGKRATRKASGKLPAF
KAPQLATLVTKVPAGDAWLNEAKFDGYRLVCAVGAGTVRCYTRNGLDWTEKFPAIAAALA
ELDCQSALIDGEVVALSEGGSTFSALQKALRTGASTRLYAFDLIELDGKDLSRKPLVERK
ERLEALLQTLGATSTVQFSEHVRGNGEHVLSAICKAGQEGIIAKEADAPYRSGRSRSWLK
VKCTKRQEFVIGGYTPSSKKGRAFASLLVGTFEGGKLIYRGGVGTGFSGKTMEDLAAAFA
KRKRDTSPFDSVPRERMRNSVWLEPDLVAEVDFAEFTADGHVRHGSFEGLREDKEARAVK
LETPKPAEAEPETAKSKSSARTRKTPPVQGDADVLGIRISHPDRVLFEGQGITKIDLARY
YAVVAERMLPFAADHPVSLVRCPQGGERHCFFQKHASDGFPEAIREVPITESSGDTENYM
YIHDAKGLVAAVQMGTLEFHIWGSSIDRLEKPDRLVFDLDPDPSVDFETVKAAALRLRDE
LAEIGLKTVPMVTGGKGVHVIVPLRPHAEWEEAKGFAKALARSIAERDPDNFVATMSKAK
RKGKIFIDWLRNDRGATAIAPYSTRARSGGPVATPVGWDELQGLEAANGFQIPDIIERIE
AGTDPWREIGKISQSLTKKILNSVE
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcgcaatgaaccgctttccgaatataaccggcgccgcgatttcacgcggacg
agcgaacccaagggagcggtcgctcggcgcagcggggacaacaggatgcggttcctggtt
cagaagcacgctgcgacccgcctgcattacgacttccgcctggaatgggagggcgtgctg
aagagctgggcggtcacacgcggcccgagcctcaaccccgaagacaagcgcctggccgtg
cgtaccgaagaccacccgcttgcctatggcgacttcgaaggaacgataccgaagggagag
tatggcggcggtaccgtgatgctctgggataccggctggtgggagccggaggatgacccg
tcgaaagccctgaagaagggcaagctctccttcaagctgcatggcagccgaatgaagggc
ggctgggcgctggtgcgcatgcggccacccgaaggcgaaaagcgcgagaactggctgctc
gtcaaggaaacggacgatgtcgcctccgatgacggcgagagcctgatcaacgagaacatc
accagcatcgttaccggccggacgatggaggagatcgccgaaggcaggggcgagaagcgg
gcgcgggtctggcattccaacaaaagcatctcggccaatctcaaggccggcgcgatcgcc
gaaaacggcaatgcaggcaagcgcgcgacgcgaaaagcctccggcaagctgcccgccttc
aaggcaccgcagctggcgactctggtgaccaaggtgcccgccggcgacgcatggctgaac
gaagccaagttcgacggctaccgtcttgtctgcgccgtcggtgccggcaccgtgcgctgc
tacacgcgcaacggcctcgactggaccgagaagttcccggcaattgccgccgcccttgcc
gaactcgactgccagtccgctctgatcgatggcgaagtggtggcgctttcggaaggcgga
tcgaccttctcggccctgcagaaggcgcttagaacgggggccagcacacggctttacgct
ttcgatctcatcgagctcgacggcaaggatctgagccggaagccgctcgtggaacgcaag
gaacggctcgaagcgctgctccaaacgctcggcgccacctctaccgtacaattcagcgag
catgtccgcggcaatggcgagcacgtgctttccgcgatatgcaaggccggccaggagggt
ataatcgccaaggaggccgatgccccctatcgcagcgggcgcagccgaagctggctcaag
gtgaaatgcacgaagcgccaggagttcgtgatcggtggctataccccgtcttcaaagaag
gggcgtgccttcgcctcgctgctcgtcgggaccttcgaaggcgggaagctgatctaccgt
ggcggcgtcggcaccggtttcagcggaaagacaatggaggacctcgccgcggccttcgca
aagcgcaagcgcgatacgtcgcccttcgacagcgtgccgcgagagagaatgcgaaattcg
gtatggcttgagccggacctggtggcggaggtggatttcgccgaattcacggccgacgga
catgtccgtcacggttcattcgagggattgcgcgaggacaaggaggccagggccgtgaaa
ctggagacaccgaagccggcagaagcggagccggagaccgccaagagcaaatcttccgcc
aggacgcgcaagacgccgcctgtgcagggagacgccgatgtcctcggcatccgcatctcc
catccggaccgggtgctcttcgaaggccagggcatcaccaagatcgatctcgcccgctat
tacgccgttgtcgccgagaggatgctcccctttgccgccgatcaccccgtttcgctggtg
cgctgcccgcagggcggcgagcggcactgtttcttccagaaacacgcaagcgacggcttt
cccgaggcgatccgggaagtgccgattaccgagtcatcgggcgacaccgagaactatatg
tacatccacgatgccaagggcctcgtcgccgccgtgcagatggggacgctcgagtttcac
atctggggttcaagcatcgaccggctggagaaacccgaccgtctggtcttcgatctcgac
cccgatccgagcgtcgacttcgagacagtcaaggcggcagccctcaggctccgcgacgaa
ctcgccgagatcggcctgaaaacagtgcccatggtgaccggcggcaagggcgtccacgtc
atcgttccgctccgcccccatgccgaatgggaggaggccaaaggcttcgcgaaagcgctc
gcgcgatctatcgccgagcgcgatccggacaatttcgtcgccaccatgtcgaaggcgaag
cgcaagggaaagattttcatagactggctgagaaacgatcgcggcgccacggcgatcgcg
ccctattccacccgcgcgcgctccggcggaccggtcgccacaccggtcggctgggacgaa
ctccaaggcctcgaagccgccaacgggtttcagattccggacattatcgagcggatcgaa
gccgggaccgatccgtggcgggagatcggcaagatcagtcagtcgctgacgaagaagata
ttgaactcggtcgaatga

DBGET integrated database retrieval system