KEGG   Selaginella moellendorffii: SELMODRAFT_128137Help
Entry
SELMODRAFT_128137 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smo03400]
    SELMODRAFT_128137
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     SELMODRAFT_128137
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     SELMODRAFT_128137
DNA repair and recombination proteins [BR:smo03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     SELMODRAFT_128137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HIRAN
Motif
Other DBs
NCBI-GeneID: 9638577
NCBI-ProteinID: XP_002988561
JGI: 128137
UniProt: D8SYT0
LinkDB All DBs
Position
Unknown
AA seq 764 aa AA seqDB search
MNFSSTAILVWILLCFDSSTLIDGVSCPDTCLQRGKKKKNSVQHTLFHFNLSKKVEYEES
GNCVLEIQQSPPLETGVDCNTAAGSPEPEVSSTLECFEEPDVANSVLPAELNSETRDLYN
GCLEARIAGRKYHRDVECQAGMRVHLVREPENPMDTYAVKVLTADGLSLGHIPKELSRYL
SPLMEKGVVDVQGYVSKSTSEAARLKLDLREIQSRTIGSLSEEKVLAVKWSRLMDAADKG
QDHGCRYQQNFLYMLQVVLERDLHLFTSDEIELLEAFRSISSDGQRLFVRLAQRKGPWFR
LQNIFYEDIGDTNSAVHELVGTQFLSSFFDADVNSSELLEHLTVQELKDLAVNSKIMVVT
SKTFFLVFISVPAYRSKREILGGSNLTALIREATGPCIRIAETVEVLLWRLQRLFFLNGE
QEFHVFLLVDIGRIKYPSYRCARTMPVFASREDFLAYEQALQLAQVVDMSLEAGNSEAVN
SSFRKARTTLELINAHTEIKHPFLARFSAAWVYATICTVAASFLEKERRYAEAINLFKQL
LSMQYCPGRRGYWTLRLSIDLEHLQRLEESLLVAENGLNDFSVRGGDRIALQRRVLRLGK
PPRRWKVPPYAALLKKKQKVVTIMGRPLNNANGMKSRFYGYDGQQCSVEDLALQYYAGED
GGGWKGVHSESGIWLTLFGLLMWDVIFSDVPDVFQTPFQVLVSFSRGCSTVLVCRLHHWT
CARIHSIQSEARLLNLVFKPYAMAELGNSWLRLGQSTTGHHVAG
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaacttctcgtcaactgccatcttggtttggattttgctctgttttgattcaagcacg
ctgatcgatggtgtctcttgtccagatacttgcctgcaacgtgggaagaaaaagaagaac
agtgtccagcatacactctttcacttcaacttgtcgaaaaaggtagagtacgaggaaagc
ggaaactgcgtactagaaatccagcagtctcctccgctcgagactggggtcgactgtaac
acggcggcagggtctccggaaccggaagtttcttctactcttgaatgctttgaggagccc
gacgtggccaacagcgtccttccggcagagctcaacagtgaaactagagatctttacaat
ggctgcctggaggcaaggattgctggccgcaagtaccacagagacgtcgagtgccaagct
gggatgcgagttcacctggtaagggaaccagaaaatcccatggatacatacgctgtgaag
gtgcttacagcggatgggctttcgctgggacatattccaaaagagctttcgcgttatttg
tctcctctcatggaaaaaggcgtggtagacgttcagggatatgtctccaagagtacatcg
gaagctgcacgcctcaagcttgatttgcgtgagatccagagtcggactattggaagtctc
tcagaagaaaaagtgctggctgtcaaatggagccgtctgatggatgcagctgacaaggga
caagaccacggctgtcgataccaacagaattttctctacatgctccaagtggtattggaa
cgggatctccatctctttacttcagacgagatcgaacttctcgaggcatttcgttcaatc
tcgtctgatggacagcgcctttttgtaagattggctcaacgaaaggggccatggttccgt
cttcagaacattttctatgaagatattggtgacacaaactctgcagtccatgagttagtc
ggtactcaatttctttcatcgtttttcgacgcggacgtcaattcgtctgagttgcttgaa
catctgactgtacaagagctcaaagatttggcagtgaacagcaaaatcatggtagttact
tctaagactttcttccttgtttttatttctgttcctgcttacagatcaaaacgtgaaata
cttggcggcagtaatctaacggctttaattcgtgaagcaaccggcccatgcattcgaata
gccgaaacagttgaagttctactttggcgtttacagaggctgttctttctaaacggtgag
caggagttccatgtttttcttcttgtggatattggaaggatcaagtatccaagctatagg
tgcgctagaacaatgccagtctttgcttctcgagaggactttctggcgtatgagcaggca
ttgcaattggctcaggtggttgacatgtctctggaagctggtaattctgaggctgtaaac
tcctcttttcgaaaagcaaggactactctcgaattgatcaatgcacacaccgagatcaag
catccatttttagcacgattttcggctgcatgggtgtatgcaacaatctgtactgtggct
gcatcgtttctggagaaagaacgcagatatgctgaagctataaacctcttcaagcagctc
cttagcatgcagtattgtcctggacggagaggatactggactctccggctatctattgac
ttggagcacttacagcgtttagaagagagcctgctcgttgcagaaaacggattaaatgat
ttcagcgtccgaggaggggatcgtattgctttgcaacggagggttctccgactaggaaaa
cctcctagaaggtggaaagtacctccatatgcagcgcttttaaagaaaaaacaaaaggtg
gtgacgattatgggaaggccgctaaacaatgccaatggaatgaagagcagattttatggc
tacgatgggcaacaatgcagtgtggaggacctggcacttcaatactatgccggagaagat
ggaggcggctggaaaggagtccattcagaaagtggcatatggctgacattgttcgggctg
ctcatgtgggatgttatcttttcagacgttccagatgtcttccagacaccttttcaggtt
cttgtttcattttctcgtggttgctctacagttcttgtttgcagactgcaccattggact
tgtgcacggattcattctatccagtccgaagctcgcttattgaatctcgtcttcaagcca
tacgcgatggcggagctaggcaactcgtggctgagacttgggcagagcactacgggacat
catgtagcggggtaa

DBGET integrated database retrieval system