Selaginella moellendorffii: SELMODRAFT_95006 Help Entry SELMODRAFT_95006  CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism smo  Selaginella moellendorffii Pathway smo03020   RNA polymerase smo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SELMODRAFT_95006   09124 Replication and repair    03420 Nucleotide excision repair     SELMODRAFT_95006  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:smo03021]     SELMODRAFT_95006    03400 DNA repair and recombination proteins [BR:smo03400]     SELMODRAFT_95006 Transcription machinery [BR:smo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      SELMODRAFT_95006 DNA repair and recombination proteins [BR:smo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SELMODRAFT_95006 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TFIIS_C RNA_POL_M_15KD zinc_ribbon_4 Motif Other DBs NCBI-GeneID:  9642356 NCBI-ProteinID:  XP_002971047 JGI:  95006 UniProt:  D8QRR8 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MSTMKFCRECNNILYPKEDRDQKLLLYACRNCDHQEAADNNCVYRNEVHHTADERTQVLQ DVASDPTLPRTKDVRCSRCKHGEAVFFQATARGEEGMTLFFVCCNPNCGYRWRD NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagtaccatgaagttctgccgcgagtgcaataatattttgtacccaaaagaggatcgt gaccagaagctgctcctgtacgcttgtcgcaactgcgatcaccaggaggctgccgacaac aattgcgtgtatcggaacgaagttcatcacacagccgatgagagaacgcaggttctccaa gatgttgcgtcggatcccacgcttccccgcacaaaggatgtgcgatgctcgcgatgcaag catggagaagcagtcttcttccaggcaacagcgaggggtgaggaagggatgacgctattt ttcgtatgctgtaatcccaattgcggctatcgctggagggattga

DBGET integrated database retrieval system