KEGG   Streptococcus mutans UA159 (serotype c): SMU_712Help
Entry
SMU_712           CDS       T00100                                 

Gene name
capP
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00620  Pyruvate metabolism
smu00680  Methane metabolism
smu01100  Metabolic pathways
smu01120  Microbial metabolism in diverse environments
smu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMU_712 (capP)
  Energy metabolism
   00680 Methane metabolism
    SMU_712 (capP)
Enzymes [BR:smu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SMU_712 (capP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 1027829
NCBI-ProteinID: NP_721135
UniProt: Q8DV10
LinkDB All DBs
Position
668354..671077
Genome map
AA seq 907 aa AA seqDB search
MTINKLESRNDKEAIAEEITILTKLLDDATKTMVGSASFDKITLFKKLSIEEKHQELERE
IEQLTNEEMVVVSRYFSILPLLINISEDVNLAYEINYQNNNDIDYLGKLSATIELVSSQK
NAQEILENVNVVPVLTAHPTQVQRKTMLDLTNHIHELLRKYRDVKAGSINKQKWYDDMRR
YVELIMQTDIIREKKLKVTNEITNVMEYYNSSLIKGVTKLITEYKHLSHQKGFDLGNAKP
ITMGMWIGGDRDGNPFVTAETLKISALVQNEVILNYYIDKVSDLYRTFSLSTSLSTISNA
VKEMADRSTDVSIYREKEPYRKAFHYIQSRLQETLIYLKNNHLEELESEDSAQILPYQSA
QEFRNDLQLIKDSLLENNGSAFITGDLTELLQAVDVFGFFLASIDMRQDSSVHETCVAEL
LASANIVANYSDLPEEEKIAILLKELTEDPRILSATHVEKSEILQKELAIFKTARKLKDA
LGEDVIKQHIISHTESISDMFELAIMLKEVGLVDTDKARVQIVPLFETIEDLDNSREIMR
QYLNYDIVKKWIAANHNYQEIMLGYSDSNKDGGYLSSGWALYKAQNELTEIGYDNGVKIT
FFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEVIGNKYGNKDVAYYNLEMLVS
ATLDRMVTRRIVNSDNLVNYRLIMDEIVADSNLIYRDLVFGNEHFYDYFFAASPIREVSS
LNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFPGWYGVGSAFKHFIDKDEKNLTKLQ
EMYQSWPFFHSLLSNVDMVLSKSNMNIAFEYAKLCQDEETKEVFATILDEWQLTKNVILA
IESHKQLLEDNSYLKASLDYRLPYFNVLNYIQIELIKRQRRGELGENLENLIHITINGVA
TGLRNSG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaacaaactagaaagtagaaatgataaagaagcaattgctgaggagattact
attcttaccaaactactggacgatgctaccaaaacaatggttggcagtgctagctttgat
aagattaccctctttaaaaaattatcaattgaagagaagcatcaagagttagaacgtgaa
attgagcagttaacaaatgaagaaatggtcgttgtttctcgttatttctccattttaccg
cttcttatcaatatttctgaagatgtcaatttagcttatgaaatcaactatcaaaacaat
aatgatattgattatttagggaaattatcagccactattgaacttgtttctagtcaaaaa
aatgctcaagaaattctggaaaatgttaatgttgtccctgttctaacagcgcatccaact
caagtgcagcgaaaaacgatgctggatttaactaatcatattcatgaacttttgcgtaag
taccgtgatgttaaagctggatctattaacaagcaaaaatggtatgacgatatgcgccgt
tatgttgagctcattatgcaaacagatattattcgtgaaaagaaattaaaagtcactaat
gaaattactaatgtcatggaatactataattcctctctgattaagggtgttactaaatta
attacagaatacaagcacttgtctcatcaaaaaggatttgatttaggaaatgctaaacca
attacgatgggaatgtggattggcggtgaccgtgatgggaatcctttcgtcactgctgaa
accctgaaaatatcagctctggtgcaaaatgaagtgattttaaattattatattgacaaa
gtttcagatctttatcgaacattttctctttcaaccagcctttctactattagcaatgca
gttaaagagatggcagatcgttcaacggatgtttcgatttaccgagaaaaagaaccctat
cgtaaggcttttcattatattcaatcaagattgcaagagactcttatttatttaaaaaac
aaccatttagaagagttggagtctgaagatagtgctcaaatccttccttatcaatcagcg
caagagtttagaaatgatttgcaactcatcaaagattctcttttagaaaataacggttct
gcttttattacgggtgatttaacagaattattgcaggcagttgatgtttttggtttcttt
ttagcttctattgatatgcgacaagattccagtgttcacgaaacctgtgtagcagaactg
ttagcttcagccaatattgttgctaactatagcgacttacctgaagaagaaaagattgct
attcttctcaaagaattgactgaagatcctcgaatactgtctgcaacgcatgttgaaaaa
tcggaaatattgcaaaaggaattagctatttttaaaacagctaggaaattgaaggatgct
ctgggagaagatgtgattaaacaacatatcatttcacacacagaaagcatttctgatatg
tttgaattagctatcatgctcaaagaagttggcttggttgatacagataaggcgcgtgtg
caaattgttcctttatttgaaaccattgaggacttggataattctcgcgaaatcatgaga
cagtatctcaattatgatattgttaaaaaatggattgcagccaatcataattatcaggaa
attatgctgggttactcagattctaacaaggatggtggttatttatcgtctggctgggcg
ctctacaaagcacaaaatgaattgacagaaattggttatgataatggtgttaaaatcacc
tttttccatggacgcggcggtactgttggacgtggtggcggtccatcttatgaggctatt
acatcacagccatttggttccatcaaggatcggattcgtttaacagaacagggtgaggtt
attggtaataaatatggcaataaggatgttgcatactacaacctggaaatgctggtttca
gcaactcttgatcgcatggtgacaagaaggattgtcaattcagataacttagtcaattat
cgtttaatcatggatgaaattgttgctgacagtaatctcatttatcgtgatttagttttc
ggaaacgaacatttctatgattatttcttcgcagctagtccaattcgcgaagtttcaagt
ttgaatattggttcccgtccagcagctcgtaagacgattacagagatcagcggtttgcgc
gctattccttgggtattctcatggtctcaaaatcgcatcatgtttccaggatggtacggt
gttggttcagcatttaaacattttatagataaggatgaaaagaatttgactaaattgcag
gaaatgtatcaatcatggcctttcttccattcattgttgtcaaatgttgacatggtttta
tccaaatcaaatatgaatattgcctttgaatatgctaaattatgtcaggatgaagaaaca
aaagaagtctttgcaactattttggatgaatggcaattaaccaaaaatgttattctagca
attgaaagtcacaaacagcttttagaagataatagttatttgaaagctagtcttgattat
cgtttaccttactttaatgttttaaattatattcaaattgagttaattaaacgtcagcgc
cgtggtgaattaggtgagaatttagagaacctgattcacattactattaatggtgtcgca
actggtttacgaaattcaggttaa

DBGET integrated database retrieval system