KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_03350Help
Entry
SMUGS5_03350      CDS       T02185                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Brite
KEGG Orthology (KO) [BR:smut00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMUGS5_03350
Enzymes [BR:smut01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SMUGS5_03350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Thi4 HI0933_like AlaDh_PNT_C FAD_binding_3 DAO NAD_binding_8 Ribosomal_L21p FMO-like K_oxygenase Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: AFM81195
LinkDB All DBs
Position
704050..705582
Genome map
AA seq 510 aa AA seqDB search
MALDAEIKEQLGQYLQLLESEIVLQAQLKDDANSQKVKEFLQEIVAMSPMISLEEKELPR
TPSFRIAKKGQESGVEFAGLPLGHEFTSFILALLQVSGRPPKVETDIVKRIQAVDEPMHF
ETYVSLTCHNCPDVVQAFNIMSVVNPNISHTMVEGGMFKDEIEAKGIMSVPTVYKDGTEF
TSGRASIEQLLDLIAGPLKEDAFDDKGVFDVLVIGGGPAGNSAAIYAARKGVKTGLLAET
MGGQVMETVGIENMIGTPYVEGPQLMAQVEEHTKSYSVDIMKAPRAKSIQKTDLVEVELD
NGAHLKAKTAVLALGAKWRKINVPGEKEFFNKGVTYCPHCDGPLFTDKKVAVIGGGNSGL
EAAIDLAGLASHVYILEFLPELKADKILQDRAEALDNITILTNVATKEIIGNDHVEGLRY
SDRTTNEEYLLDLEGVFVQIGLVPSTDWLKDSGLALNEKGEIIVAKDGATNIPAIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattagacgcagaaatcaaagagcagttaggacagtatcttcaattacttgagtct
gagattgttttacaagctcaattaaaagacgatgctaattctcaaaaagttaaggaattt
ctccaagaaatcgttgcaatgtctcctatgatttctttagaagaaaaggaacttccgcga
acacctagttttcgcatagctaaaaaggggcaagaatctggtgttgaatttgctggctta
ccccttggtcacgaatttacttcgtttatcttggctctgttacaggtttcagggcgtccg
cctaaggtagagactgatattgtcaaacgcattcaagctgttgatgaacctatgcatttt
gaaacctatgttagtttgacttgtcataattgtccagatgttgttcaggctttcaatatc
atgtcagttgttaatcccaacatttcacatacaatggtggaaggtggcatgtttaaagat
gaaattgaagctaagggaattatgtctgtgccaactgtctataaagatggaacagaattt
acctcagggcgtgctagcatagagcaattactagacttgatagcaggtcctcttaaagaa
gatgcttttgatgataaaggtgtttttgatgtccttgttattggtgggggtcctgctggt
aatagcgcggctatctatgctgcaagaaagggagttaaaacaggacttttagctgaaacc
atgggtggtcaagttatggaaaccgtgggtattgaaaatatgatcggtaccccatatgtt
gaaggaccccaattaatggctcaggtggaagagcataccaagtcttattctgttgacatc
atgaaggcaccgcgtgctaagtctattcaaaagacagacttggttgaagttgaacttgat
aatggagctcatttgaaagcaaagacagctgttttggccttaggtgccaagtggcgtaaa
atcaatgtaccaggagaaaaagaattctttaataaaggtgttacttactgtccgcactgt
gatggtcctcttttcacagacaaaaaagtcgctgtcattggcggtggaaactcaggttta
gaagcagctattgatttggctgggttagctagccatgtctatattttagaatttttacct
gagttaaaagctgataagatcttacaagatcgtgcggaagctcttgataatattaccatt
ctaactaatgttgcgactaaagaaattattggcaatgaccacgtagaaggtcttcgttac
agtgatcgtacgaccaatgaagagtacttgcttgatttagaaggtgtttttgttcaaatt
ggattggtacctagtactgactggttaaaggatagtggactagcactcaatgaaaaaggt
gaaatcattgttgctaaagatggcgcaactaatattcctgctatttttgcagctggtgat
tgcacagatagtgcctacaaacaaattatcatttccatgggttctggagctactgcggct
ttaggtgcctttgattatttgattagaaattaa

DBGET integrated database retrieval system