Serratia marcescens WW4: SMWW4_v1c20670 Help Entry SMWW4_v1c20670    CDS       T02448                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism smw  Serratia marcescens WW4 Pathway smw00362   Benzoate degradation smw00622   Xylene degradation smw01100   Metabolic pathways smw01120   Microbial metabolism in diverse environments smw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:smw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     SMWW4_v1c20670    00622 Xylene degradation     SMWW4_v1c20670    00621 Dioxin degradation     SMWW4_v1c20670 Enzymes [BR:smw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      SMWW4_v1c20670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  AGE17868 LinkDB All DBs Position complement(2242587..2242796) Genome browser AA seq 69 aa AA seqDB search MPYVNIKVTDEGVSAAQKRMLIEGTTALLEQVLNKPRHTTFVVIDEVATDNWGVGGESVT ALRAKERGE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgccatacgtcaacattaaagtgaccgacgaaggggtcagcgccgcgcaaaagcgcatg ctgatcgagggaaccaccgcgctgctggagcaggtgctgaataagccacgccacaccact ttcgtggtgattgacgaggtagccaccgacaactggggcgtcggcggagagagcgtcacc gccctgcgcgccaaagaacgaggcgaatga

DBGET integrated database retrieval system