KEGG   Serratia marcescens WW4: SMWW4_v1c34350Help
Entry
SMWW4_v1c34350    CDS       T02448                                 

Gene name
yfcG
Definition
(GenBank) GSH-dependent disulfide bond oxidoreductase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMWW4_v1c34350 (yfcG)
Enzymes [BR:smw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     SMWW4_v1c34350 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGE19225
LinkDB All DBs
Position
3715744..3716373
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEVGLPYRIHRVNISAGEQFKPDFLSISPNNKIPAIVDQQP
VDGGAPISLFESGEILLYLAEKTGKLLSKGLRERAATLQWLFWQVAGFGPMLGQNHHFNH
YAPQPVPYAIERYHLETKRLYGVLDAELQKHPYLGGDNYSIADIATYPWVVSHPRQRIDL
ADYPAVRNWFERISNRPATERAYKLAEQA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctgtattacgcgcctactcccaatggtcacaagatcaccttgtttctggaa
gaggtcggcttgccctaccgtatccatcgcgtaaacatcagcgccggcgagcagttcaaa
ccggactttctgagcatttctcccaacaacaaaatcccggcgattgtcgatcagcaaccg
gtggacggcggcgcgccaatcagcctgttcgagtccggggaaatcctgctgtatctggcg
gagaagaccggcaagctgctgagcaagggcctgcgcgaacgcgccgccaccctgcagtgg
ctgttctggcaggtggccgggttcgggccgatgctcgggcagaatcaccactttaaccac
tacgcgccgcagccggtgccttacgccatcgagcgttaccatctggaaaccaaacggctg
tacggcgtgctggacgctgaactgcaaaaacacccgtacctgggcggcgataactacagc
atcgcggatatcgccacctacccgtgggtggtgtcgcatccgcgccagcgcatcgatctg
gcagattacccggcggtgcgcaactggttcgagcgcatcagcaaccgcccggcgaccgag
cgcgcctacaaactggccgaacaagcctaa

DBGET integrated database retrieval system