KEGG   Stackebrandtia nassauensis: Snas_1916Help
Entry
Snas_1916         CDS       T01194                                 

Definition
(GenBank) Acetylornithine transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00250  Alanine, aspartate and glutamate metabolism
sna00410  beta-Alanine metabolism
sna00640  Propanoate metabolism
sna00650  Butanoate metabolism
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Snas_1916
   00650 Butanoate metabolism
    Snas_1916
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Snas_1916
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snas_1916
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sna01007]
    Snas_1916
Enzymes [BR:sna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Snas_1916
Amino acid related enzymes [BR:sna01007]
 Aminotransferase (transaminase)
  Class III
   Snas_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADD41612
UniProt: D3PZD8
LinkDB All DBs
Position
2031930..2033183
Genome map
AA seq 417 aa AA seqDB search
MAQLSPLLKQATPVVVDHGEGVYLFDSDGRRYLDFTAGIGVTSTGHCHPKVVQAAQEQVG
KLIHGQYTTVMHQPMLELTRRLGEVLPPGLDSLFYSNSGSEAVEAALRLSRQATGRPNVV
VFHGGFHGRTVAASTMTTSGTRFSAGFSPLMSGVHVAPFPNAYRYGWDERTATEFALREL
DYLFATLSAPNETAAFFIEPVLGEGGYVPANTAFLQGLRERADEHGILLVIDEIQTGFGR
TGKFWGHDHFDVRPDIVLIAKGLASGFPISGIAASKELMSKAWPGSQGGTYGGNAVACAA
ALATLEVIQEEGLVDNAAARGLQLLEGARQIGDKTPAIGDVRGLGLLVGSEFTTPDGKPD
TATAQAAQKEAAARGLLMLTCGAHMNVVRMIPALVVNSEQIDEALGIWADVVADVAK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctcagctctccccactgctcaaacaggcaactccggtcgtcgtcgatcacggcgag
ggcgtgtacctcttcgactccgacgggcgccgctacctggacttcaccgcggggatcggt
gtgaccagcaccggccactgccaccccaaggtagtgcaggcggcgcaggaacaggtcggc
aagctgatccacggccagtacaccacggtcatgcaccagccgatgctcgaactgaccagg
cgtctgggcgaggtgctcccgcccggactcgactcgctgttctactccaactccggcagc
gaggccgtcgaggccgcgctgcgactgagccgccaggccaccggcaggcccaacgtcgtg
gtcttccatggcggcttccacggccgcaccgtcgcggcctcgaccatgaccacctcgggc
acccggttcagcgcgggcttctcgccgctgatgtcgggcgtgcacgtcgcgccgttcccc
aacgcctaccgctacggctgggacgagcgcaccgccaccgagttcgcgctgcgggaactg
gactacctgttcgccacgctcagcgcgcccaacgagaccgccgcgttcttcatcgagccg
gtgctgggcgagggcggctacgtcccggccaacaccgcgttcctgcagggcctgcgcgaa
cgcgccgacgagcacggcatcctgctggtgatcgacgagatccagaccggcttcggccgc
accggcaagttctggggccacgaccacttcgacgtccgccccgacatcgtcctgatcgcc
aagggcctggcctccggcttcccgatctcgggcatcgccgcgtccaaggaactcatgtcc
aaggcgtggccgggttcgcagggcggcacctacggcggcaacgcggtggcctgcgccgcc
gccctggccactttggaggtcatccaggaggagggtctggtcgacaacgccgccgcccgc
gggctccagctgctggagggcgcccgccagatcggcgacaagaccccggccatcggcgac
gtgcgcgggctgggcctgctggtcggctcggagttcaccacccccgacggcaagccggac
accgccaccgcccaggccgcgcagaaggaggccgccgcgcgcggcctgctgatgctcacc
tgcggcgcccacatgaacgtcgtgcgtatgatcccggcgctggtcgtcaactccgaacag
atcgacgaggcgctgggcatctgggccgacgtcgtcgccgacgtcgccaaatag

DBGET integrated database retrieval system