KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_11913Help
Entry
HMPREF0837_11913  CDS       T01259                                 

Definition
(GenBank) D-ala D-ala ligase N-terminal domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00473  D-Alanine metabolism
snc00550  Peptidoglycan biosynthesis
snc01100  Metabolic pathways
snc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF0837_11913
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0837_11913
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HMPREF0837_11913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:snc01011]
    HMPREF0837_11913
Enzymes [BR:snc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HMPREF0837_11913
Peptidoglycan biosynthesis and degradation proteins [BR:snc01011]
 Precursor biosynthesis
  Amino acid ligase
   HMPREF0837_11913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ADI70141
UniProt: D6ZMM7
LinkDB All DBs
Position
complement(1753170..1754213)
Genome map
AA seq 347 aa AA seqDB search
MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDSIKTQEFSHAPGQ
EDRLMTNETIDWDKKVAPSAIYEEGAVVFPVLHGPMGEDGSVQGFLEVLKMPYVGCNILS
SSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFTKPSNMGSSVG
ISKSENQEELRQALKLAFRYDSRVLVEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAFY
DYDAKYIDNKVTMDIPAKISDDVVAVMRQNAETAFRAIGGLGLSRCDFFYTDKGEIFLNE
LNTMPGFTQWSMYPLLWENMGISYPELIERLVDLAKESFDKREAHLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacgattattcttttatatggtggacggagtgcggaacgcgaagtctctgtc
ctttcagctgagagtgtcatgcgtgcggtcaattacgaccgtttcacagtcaagactttc
tttatcagtcagtcaggtgactctatcaaaacgcaggaatttagtcatgctccggggcaa
gaagaccgtctcatgaccaatgaaaccattgattgggataagaaagttgcaccaagtgct
atctacgaagaaggtgcagtggtctttccagtccttcacgggccaatgggagaagatggc
tctgttcaaggattcttggaagttttgaaaatgccttacgttggttgcaacattttgtca
tcaagtcttgccatggataaaatcacgactaagcgtgttctggaatctgctggtattgcc
caagttccttatgtggctatcgttgaaggcgatgatgtgactgctaaaatagctgaagtg
gaagaaaaattggcttatccagtcttcactaagccgtcaaacatggggtctagtgtcggt
atttctaagtctgaaaaccaagaagaactccgtcaagccttaaaacttgccttccgatat
gacagccgtgtcttggttgagcaaggagtgaatgcccgtgaaattgaggttggcctcttg
ggtaactacgatgtcaagagcacgctacctggagaagttgtcaaggacgttgccttttat
gactacgatgccaagtatattgataacaaggttactatggatattcctgccaaaatcagt
gatgatgtggtggctgtcatgcgtcaaaatgcagaaacagccttccgtgccattggtggc
cttggtctatctcgttgcgatttcttctatacagataagggagagatttttctcaacgag
ctcaataccatgccaggtttcacccagtggtctatgtacccactactttgggaaaatatg
gggatcagctacccagaactaatcgagcgtttggttgaccttgccaaggaaagttttgac
aagcgcgaagcgcatttgatataa

DBGET integrated database retrieval system