Sphingomonas sp. NIC1: A7E77_10375 Help Entry A7E77_10375       CDS       T04479                                  Name (GenBank) isomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism snj  Sphingomonas sp. NIC1 Pathway snj00362   Benzoate degradation snj01100   Metabolic pathways snj01120   Microbial metabolism in diverse environments snj01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:snj00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     A7E77_10375    00622 Xylene degradation     A7E77_10375    00621 Dioxin degradation     A7E77_10375 Enzymes [BR:snj01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      A7E77_10375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  ANC87268 LinkDB All DBs Position complement(2178193..2178423) Genome browser AA seq 76 aa AA seqDB search MPFVSIRLAGSATKEQKAGVVADVTASLVTRLGKNPAAVQIVIEEVSTENYGAGGQLIAD RDAPQVREDADAVPSQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcctttcgtctcgatccgactggccggctccgcgaccaaggagcagaaggcaggggtc gtcgcggacgtgacggccagcctcgtcacgcgcctcggcaagaatcccgccgcggtccag atcgtgatcgaggaagtgtcgacggaaaattacggcgccggcggtcagctgatcgccgac cgcgatgcgccccaagtgcgggaggacgctgatgcggttccctcgcaatga

DBGET integrated database retrieval system