Streptomyces nodosus: CP978_29740 Help Entry CP978_29740       CDS       T06839                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism snq  Streptomyces nodosus Pathway snq00253   Tetracycline biosynthesis snq01056   Biosynthesis of type II polyketide backbone snq01100   Metabolic pathways snq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snq00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP978_29740    00253 Tetracycline biosynthesis     CP978_29740  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:snq01004]     CP978_29740    01008 Polyketide biosynthesis proteins [BR:snq01008]     CP978_29740 Lipid biosynthesis proteins [BR:snq01004]  Polyketide synthase   Component type    CP978_29740 Polyketide biosynthesis proteins [BR:snq01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP978_29740     Nonaketide PKS      CP978_29740     Decaketide PKS      CP978_29740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEV42183 UniProt:  A0A0B5DU78 LinkDB All DBs Position complement(6696620..6696889) Genome browser AA seq 89 aa AA seqDB search MASHEFTIDDLKRILREGAGADEGVDLDGDIIDTDFESLGYESLAMLETGGRIEREFGVT LDDDTLTDAKTPRALIESVNALLVPTEIG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggcttctcacgagttcaccatcgacgacctcaagcgcatcctgcgcgagggggccggc gcggacgaaggcgtcgacctcgacggggacatcatcgacaccgacttcgagtcgctgggc tacgagtccctggcgatgctggagaccggcggccgcatcgagcgcgaattcggcgtcacc ctcgacgacgacacgctgaccgacgccaagaccccgcgtgcgctgatcgagtccgtgaac gcccttctggtgcccaccgagatcggctga

DBGET integrated database retrieval system