KEGG   Streptomyces noursei: SNOUR_10485Help
Entry
SNOUR_10485       CDS       T04806                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
snr  Streptomyces noursei
Pathway
snr00511  Other glycan degradation
snr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SNOUR_10485
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SNOUR_10485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:snr02042]
    SNOUR_10485
Enzymes [BR:snr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SNOUR_10485
Bacterial toxins [BR:snr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SNOUR_10485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 BNR Laminin_G_2 DUF4185 Laminin_G_1
Motif
Other DBs
NCBI-ProteinID: ANZ15411
UniProt: A0A1B2GN78
LinkDB All DBs
Position
2357942..2359879
Genome map
AA seq 645 aa AA seqDB search
MTSDLRAHPRLRRRPRHRRAQAAAVALAATALAVLATAPARATADAPSDGFDQQVLFKAA
YEKGYFCFRIPAIVRTVRGTLLAFAEGRVHDCGDAGDIDLVLKRSTDGGRTWGPLQVVNH
GDGDTHGNPAPLVDRRTGRIILAETYNKGRTDGLSCDVPCDRTPHLQYSDDDGATWSAPR
DLTRSIRPRRWNSWYATGPVHGIQLTHGRHAGRLVFGVNAESYTGGRITANHAALVHSDD
GGTTWRVGALDTWPIARDGTFRQKPSEMTLLERSDGSIYVNGREQDGTDLGNRTAAVSRD
GGDSFTAPFRTIPDLYTPMVQASALRLPRSSGDGGHGRTLLAAPADPDRRRTMTIRSSYD
EGRTWEGVDRGARVSADWSGYSDLVAVSRTVTGLLYEGGTADARDEIRFARFTEQWLGPR
RGPDPTTPDQAPGARPALVLGGGRLTDGPFGRALSFDGTDDAVRLPYRDSLPLGNRDFTC
TLWFRYRAGAGEQPLLWMGGVGSRSPQVALEGDPAHHRITALLTAVDGARAPATAQVATA
GAYNDGRWHHLALRRTGGRMLLTVDGTATTSVADVPGSVSRTSVFGVHLGQRPDGRAQFT
GALAQVRVYRRALTDAELSRVRERNASAAGPLVLGLPLDRVAADR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcagatctccgcgcgcacccccgcctccgccgcagaccccggcaccgtcgtgcc
caggccgccgccgtcgcgctggccgccaccgccctcgccgtcctggccacggccccggcc
cgggccaccgctgacgccccttcagacggcttcgaccagcaggtgctgttcaaggcggcg
tacgagaagggctacttctgcttccgtatacccgccatcgtgcggaccgtccgcggcacc
ctcctcgccttcgccgagggccgggtgcacgactgcggggacgccggcgacatcgacctc
gtcctcaagcgctccaccgacggcggccggacctggggccccctccaggtcgtcaaccac
ggcgacggggacacccacgggaacccggcgcccctggtggaccgccgcaccggccgcatc
atcctcgccgagacctacaacaagggccgtaccgacggcctcagttgcgacgtcccctgc
gaccgcaccccgcatctccagtacagcgacgacgacggcgccacctggtccgcaccccgc
gacctgacccgcagcatccgcccccgccgctggaactcctggtacgccaccggtccggtg
cacggcatccagctcacccacgggcggcacgccgggcggctggtcttcggcgtcaacgcc
gagagctacacgggtggccggatcaccgccaaccacgccgcgctggtccacagcgacgac
ggcggcaccacctggcgggtgggcgcgctggacacctggccgatcgcccgggacggaacc
ttccgacagaagccgtccgagatgaccctcctggagcgctccgacggctcgatctacgtc
aacggccgcgagcaggacggcaccgatctcggcaaccgcaccgccgcggtgagccgggac
ggcggcgactccttcaccgcgccgttccgcacgatccccgacctctacaccccgatggtg
caggcgtccgcgctgcggctgccgcgctcgtccggcgacggcggccacggccgcaccctg
ctggccgcgccggccgacccggaccgccgccgcaccatgaccatccgctcctcgtacgac
gagggccgcacctgggagggcgtggaccggggcgcccgggtcagcgccgactggtccggc
tactccgacctggtcgccgtctcccgcaccgtcaccggcctgctctacgagggcggcacc
gccgacgcccgggacgagatccgcttcgcccgcttcaccgagcagtggctcggaccgcgc
cgtggcccggacccgaccacccccgaccaggcccccggtgcccggccggccctggtcctg
ggcggcggccggctcaccgacggccccttcggccgcgcgctgtccttcgacggcaccgac
gacgccgtgcgcctcccctaccgcgactcgctcccgctgggcaaccgggacttcacctgc
accctgtggttccgctaccgcgccggcgccggcgagcagccgctgctgtggatgggcggg
gtgggcagccgctccccgcaggtcgcccttgagggtgatcccgcgcaccaccggatcacc
gcgcttctcacggccgtcgacggcgcccgggcgcccgccaccgcccaggtcgccaccgcc
ggcgcgtacaacgacggccgctggcaccacctcgcgctgcgccgcaccggcggccggatg
ctgctgaccgtcgacggcaccgcgacgacctcggtcgcggacgtccccggatcggtcagc
cgcacctcggtgttcggcgtccacctgggccaacggccggacggtcgggcgcagttcacc
ggcgccctggcgcaggtccgcgtctaccgccgggcgctcaccgacgccgaactctcccgg
gtccgcgagcgcaacgcctcagcggccggcccgctggtgctcggactcccgctggaccgg
gtggccgccgaccgctga

DBGET integrated database retrieval system