KEGG   Streptomyces noursei: SNOUR_23565Help
Entry
SNOUR_23565       CDS       T04806                                 

Gene name
glpD2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
snr  Streptomyces noursei
Pathway
snr00564  Glycerophospholipid metabolism
snr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SNOUR_23565 (glpD2)
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SNOUR_23565 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ANZ17982
UniProt: A0A1B2GVS1
LinkDB All DBs
Position
5310830..5312539
Genome map
AA seq 569 aa AA seqDB search
MKTATLGPAQRAKALTQMAERELDLLVVGGGVVGAGTALDAATRGLDTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLQRLAPHLVRPVPFLYPLQHKGWERWY
AGSGVALYDAMSVSSGHGRGLPVHRHLSHRRALRVAPCLRRDALVGALQYYDAQMDDARY
VTTLVRTAAAYGAHVANRARVVGFLREGERVVGARVQDVEGGVEHEIRARQIVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLATPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDARVAECVTEDVPLAGAEGYRAL
WNARARVAARTGLHVARVEHLLNRYGSLSEELLEMVVADPSLGRPLAAADDYLRAEVVYA
CTHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPALGWDSAQIEKEIAHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPLT
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgacactcggaccggcgcagcgcgccaaggcactcacccagatggcggag
cgggaactggacttgctggtggtcggcggcggcgtcgtcggcgccggtaccgcgctggac
gccgcgacccgcgggctggacaccgggctggtcgaggcccgtgactgggcgtcgggcacc
tccagccggtcgagcaagctcatccacggcggcctgcggtatctggagatgctggacttc
gcgctggtgcgggaggcgctgaaggagcgcgggttgctgctccagcggctggcgccgcat
ctggtcaggccggtgccgttcctctatccgctccagcacaagggctgggaacgctggtac
gcgggctccggcgtggcgctctacgacgcgatgtcggtctcctccggccacggccggggg
ctgcccgtccaccgccacctctcgcaccgccgggcgctgcgggtggcgccctgcctgcgg
agggacgcgctggtcggcgcgttgcagtactacgacgcgcagatggacgacgcccggtac
gtcaccaccctggtgcggaccgcggcggcctacggcgcgcacgtcgccaaccgggcgcgg
gtggtgggttttctgcgcgagggcgagcgggtggtcggcgcgcgggtgcaggacgtcgag
ggcggtgtggagcacgagatccgggcccgccagatcgtcaacgcgacgggcgtgtggacc
gacgacacccaggcgctgatcggggagcgcggccagttccacgtccgcgcctccaagggc
atccacctggtcgtccccaaggaccggatccactccacgaccgggctgatcctgcggacg
gagaagagcgtgctcttcgtcatcccctgggggcggcactggatcatcggcaccacggac
accgactgggacctggacaaggcgcacccggcggcctccagcgccgacatcgactatctg
ctggagcacgtgaactcggtgctggccaccccgctcacccgggacgacgtggagggcgtc
tacgccggtctgcggccgctgctggccggcgagtcggacgccaccagcaagctgtcccgg
gagcacacggtcgcccacccggtgccgggcctggtggtcgtcgcgggcggcaagtacacc
acctaccgggtgatggccaaggacgcggtggacgaggcggtgcacgggctggacgcccgg
gtcgccgagtgcgtcaccgaggacgtgccgctggcgggcgccgagggctaccgggcgctg
tggaacgcgcgggcccgggtcgccgcccggaccggtctgcacgtggcccgggtggagcac
ctgttgaaccgttacggctcgttgtccgaggagctgttggagatggtggtggccgacccc
tcgctgggccggccgctcgccgccgccgacgactatctgcgcgccgaggtcgtctacgcc
tgcacgcacgagggcgcccggcacctcgacgacgtgctgacccggcgcacccggatctcc
atcgagaccttcgaccgcggcacccgcagcgcccgggaggccgccgagctgatggcgccg
gcgctgggctgggacagcgcgcagatcgagaaggagatcgcgcactacgagaagcgggtg
gaggcggagcgcgaatcccagcgccagcccgacgacctgacggcggatgcggcccggctg
ggcgcgccggacatcgtgccgctgacgtag

DBGET integrated database retrieval system