KEGG   Serratia odorifera: NCTC11214_04597
Entry
NCTC11214_04597   CDS       T06612                                 

Gene name
gstB_3
Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sof  Serratia odorifera
Pathway
sof00480  Glutathione metabolism
sof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sof00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC11214_04597 (gstB_3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sof02000]
    NCTC11214_04597 (gstB_3)
Enzymes [BR:sof01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NCTC11214_04597 (gstB_3)
Transporters [BR:sof02000]
 Other transporters
  Pores ion channels [TC:1]
   NCTC11214_04597 (gstB_3)
SSDB
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_C_6 Sigma70_r2 GST_N_5 Glyco_transf_8C
Other DBs
NCBI-ProteinID: VDZ63702
UniProt: A0A447KZS4
LinkDB
Position
1:4223613..4224218
AA seq 201 aa
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLAQKKTESGADYLAINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRNLIPAAGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPEE
YQVMARSRLEQQFRYLDGVLAQQQYLLGNRFSVADAYLFTVLRWAQALQFDLQQHAHLST
YMTRVAARPAVDAALSAEGLK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaactgttctataaagctggcgcctgttcgttgtcgccgcatatcgtattgcgcgaa
gcagggctggattttactgcggaaaaagtcgacctggcacaaaagaaaaccgaaagcggc
gccgactatctggccatcaaccccaagggacaggtacctgccttgctgctcgatgacggc
agcctactcaccgaaggcgtggcaattgtacaatatctggcagatcgcgttccggatcgt
aacctgatcccggcggccggcacgctctcgcgctaccatgccatcgaatggctgaatttt
gtcgccaccgaactgcacaagggcttcagcccgctgttcaaccccaaaacaccggaagaa
taccaggtgatggcgcgcagcaggctggaacagcaattccgttatctggatggcgtactg
gcgcagcagcaatatttattgggtaaccgtttcagcgtggccgacgcctacctgtttacc
gtactgcgctgggcgcaggccttgcagttcgatctgcagcaacacgcccatctgtccacc
tatatgacgcgcgtggcggcacgcccggcggttgatgccgcgctcagtgccgaaggcttg
aaataa

DBGET integrated database retrieval system