KEGG   Streptomyces parvulus: Spa2297_03360Help
Entry
Spa2297_03360     CDS       T04685                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spav  Streptomyces parvulus
Pathway
spav00072  Synthesis and degradation of ketone bodies
spav00650  Butanoate metabolism
spav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Spa2297_03360
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Spa2297_03360
Enzymes [BR:spav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Spa2297_03360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 KR ApbA NmrA 2-Hacid_dh_C ADH_zinc_N 3Beta_HSD F420_oxidored RmlD_sub_bind Ldh_1_N GDP_Man_Dehyd 3HCDH_N Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ANJ06103
UniProt: A0A191UTS7
LinkDB All DBs
Position
complement(748573..749373)
Genome map
AA seq 266 aa AA seqDB search
MTSPSVLPAPQASTLDLDGRTALVTGAAGGIGRACALRLAAAGAEVRAVDRDAAGLDALA
ESGADLAGSVLPQVLDLTDLDAAERAAAGTDVLVNNAGIQLVRPIEEFPPDVFHTVLTVM
LEAPFRLIRGALPHMYGQGWGRIVNISSVHGLRASAYKSAYVAAKHGLEGLSKTAALEGA
AHGVTSNCVNPAYVRTPLVERQIADQARAHGIPEEQVLSDVLLQDSAVRRLIEPDEVAEA
VAYLCGPQASFVTGTSLVLDGGWTAH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcccagcgtcctcccggccccccaagcctccacgctcgacctcgacggccgc
accgccctcgtcaccggcgccgccgggggcatcggccgcgcctgcgccctgcgcctggcc
gccgccggcgccgaggtcagagcggtcgaccgggacgccgccggactggacgcgctcgcc
gagagcggcgccgacctcgcgggcagcgtcctgccccaggtgctggacctgaccgacctc
gacgccgccgaacgcgccgccgccggcaccgacgtcctcgtcaacaacgccgggatccag
ctggtgcggcccatcgaggagttcccgccggacgtcttccacacggtgctcaccgtgatg
ctggaggcgcccttccggctgatccggggcgcgctgccgcacatgtacgggcagggctgg
ggccgcatcgtcaacatctcctccgtgcacggcctgcgcgcctcggcctacaagtcggcc
tacgtcgccgccaagcacggcctggagggactgtccaagacggcggccctcgaaggcgcc
gcccacggggtcacctcgaactgcgtgaaccccgcctacgtgcgcaccccgctcgtggag
cggcagatcgccgaccaggcccgcgcccacggcatcccggaggagcaggtgctcagcgac
gtactgctccaggacagcgccgtgcgccggctgatcgaaccggacgaggtcgccgaggcg
gtcgcgtacctgtgcggaccgcaggcgtccttcgtcaccggcacctcactcgtgctggac
ggcggctggaccgcccactga

DBGET integrated database retrieval system