KEGG   Streptomyces parvulus: Spa2297_18130Help
Entry
Spa2297_18130     CDS       T04685                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spav  Streptomyces parvulus
Pathway
spav00250  Alanine, aspartate and glutamate metabolism
spav00410  beta-Alanine metabolism
spav00430  Taurine and hypotaurine metabolism
spav00650  Butanoate metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav02024  Quorum sensing
Module
spav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Spa2297_18130
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spa2297_18130
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spa2297_18130
   00430 Taurine and hypotaurine metabolism
    Spa2297_18130
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Spa2297_18130
Enzymes [BR:spav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Spa2297_18130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANJ08727
UniProt: A0A191V1B9
LinkDB All DBs
Position
complement(3988244..3989665)
Genome map
AA seq 473 aa AA seqDB search
MSLHKGPRPSRDDDRDRRRLAVNPFHAAANPLGGMTEAPPAHRLPDSPLPPESAYRLVHD
ELMLDGNARLNLATFVTTWMEPQAGVLMSECRDKNMIDKDEYPRTAELERRCVAMLADLW
HAPDPETAVGCSTTGSSEACMLAGMALKRRWALRNADRYPGARPNLVMGVNVQVCWEKFC
NFWEVEARQVPMEGDRFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVADLCAALDAL
QERTGLDVPVHVDGASGAMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWR
DAEALPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQLSARDIA
RGLAERVEALGDFRLLTRGDQLPVFAFTTADDVTAYDVFDVSRRLREGGWLVPAYTFPPH
REDLSVLRVVCRNGFSTDMADLLLADLERLLPELRRQPGPLIRDKGAATGFHH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcacaagggtccccgcccgtcccgtgacgacgaccgcgaccggcgccggctc
gccgtgaacccgttccacgcggccgcgaacccgctcggcggcatgaccgaggccccgccc
gcccaccggctgccggactcaccgctgccgcccgagagcgcgtaccggctggtccacgac
gagctgatgctggacggcaacgcccggctgaacctggccaccttcgtcaccacctggatg
gagccgcaggccggggtgctgatgagcgagtgccgggacaagaacatgatcgacaaggac
gagtacccgcgcaccgcggagctggaacggcgctgcgtggcgatgctcgccgacctgtgg
cacgcgccggacccggagacggccgtgggctgctcgacgaccgggtcgagcgaggcgtgc
atgctcgccgggatggcgctgaagcggcggtgggcgctgcgcaacgccgaccggtacccg
ggagcgcggcccaacctggtgatgggcgtgaacgtgcaggtctgctgggagaagttctgc
aacttctgggaggtggaggcgcggcaggtgcccatggagggcgaccgcttccacctcgac
ccgcaggccgccgccgagctgtgcgacgagaacacgatcggcgtcgtcggcatcctgggc
tccaccttcgacgggtcctacgagccggtcgccgacctgtgcgccgccctggacgccctc
caggagcgcaccggcctcgacgtcccggtccacgtcgacggggcctcgggcgccatggtc
gcgccgttcctcgacgaggacctggtctgggacttccggctgccgcgggtcgcctcgatc
aacacctcggggcacaagtacgggctggtctacccgggcgtcggctgggcgctgtggcgg
gacgcggaggcgctgcccgaggagctggtgttccgcgtgaactacctgggcggcgacatg
ccgaccttcgcgctgaacttctcccggcccggcgcgcaggtggtggcgcagtactacacg
ttcctgcggctgggccgggagggctaccgggcggtgcagctctccgcgcgggacatcgcc
cgcgggctcgccgaacgggtggaggcgctcggggacttccggctgctgacgcgcggcgac
cagctgccggtgttcgccttcacgaccgccgacgacgtgacggcgtacgacgtgttcgac
gtctcgcggcggctgcgggagggcggctggctggtgccggcgtacaccttcccgccgcac
cgcgaggacctgtcggtgctgcgggtggtgtgccgcaacggcttctccaccgacatggcc
gacctgctgctggccgacctggagcggctgctgccggagctgcggcgccagccgggaccg
ctgatccgggacaagggcgcggcgaccgggttccaccactag

DBGET integrated database retrieval system