KEGG   Streptomyces parvulus: Spa2297_27290Help
Entry
Spa2297_27290     CDS       T04685                                 

Definition
(GenBank) laminin G
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
spav  Streptomyces parvulus
Pathway
spav00511  Other glycan degradation
spav00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Spa2297_27290
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Spa2297_27290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:spav02042]
    Spa2297_27290
Enzymes [BR:spav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Spa2297_27290
Bacterial toxins [BR:spav02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Spa2297_27290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR BNR_3 Laminin_G_2 Laminin_G_1 DUF4185
Motif
Other DBs
NCBI-ProteinID: ANJ10358
UniProt: A0A191V632
LinkDB All DBs
Position
complement(6035470..6037353)
Genome map
AA seq 627 aa AA seqDB search
MPSRPPRSLRPALAAALATATAFAAATAPPPAYARPGERAPEFEERVLFRADADPGGYAC
FRIPAIVRTTEGTLLAFAEGRVLNCGDAADIDIVVKRSTDGGRTWGPLQVVNDGGGDTHG
NPAPVVDRATGRVLLTETYNAGRTDAANCAIPCTRTPHLQHSDDDGVTWSAPRDLSPEIL
PAEWNSWYATGPVHGVQLTGGGHPGRLVVGVNAETWDGDRITANHAALVVSDDGGAHWKV
GATDTWPVAADGTFRQKPSELTLTERADGALLVSGREERGTDLGHRTQALSLDGGDSFAA
PFRALPDLYTPQVQGAVLRMGDRTLLSAPADPDRRRTMSVRSSYDGGATWDSVDRGTVLT
RDWSGYSDMVDVDDATVGLLYEAGAVDARDEIRFARFTEDWLQARRAADPTTPDLAPGAA
PAAVLGGAGPTTGAVGGALSFDGADDAVRLPFDERLPLGDGDFTASLRFRYSEADGEQPL
LWMGGVGIAQPQVWLRAEPAHGRVQGLITARDGAAAPRSAWVRTDDALNDGRWHHLALRR
GGGRLTLFVDGEQTGAADVPGSVSTGSPFGVHVGERVDGRARLRGAVDEVHVWNRALTDE
EIAAGDPPSALANAVVHLPLDGTSAGG
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcccgacccccccgttctctcaggcccgctctcgccgcggccctcgccaccgcc
accgccttcgccgccgccaccgccccgccgcccgcgtacgcccggccgggcgagcgggcc
cctgagttcgaggagcgggtcctcttccgggcggacgcggacccgggcggctacgcctgc
ttccgcatccccgcgatcgtccggacgaccgagggcaccctgctcgccttcgccgagggg
cgcgtcctcaactgcggggacgccgccgacatcgacatcgtcgtcaagcgctccaccgac
ggcggacgcacctggggcccgctccaggtcgtcaacgacggcggcggcgacacccacggc
aacccggcgccggtcgtcgaccgggccaccggccgcgtcctgctgaccgagacctacaac
gcgggccggaccgacgccgccaactgcgcgatcccctgcacccgcacgccccacctccag
cacagcgacgacgacggcgtcacctggtccgcgccccgcgacctgagccccgagatcctg
ccggccgagtggaactcctggtacgccaccggacccgtgcacggcgtccagctcaccggc
ggcggccaccccgggcggctcgtggtcggcgtcaacgccgagacctgggacggcgaccgg
atcaccgccaaccacgcggcgctggtggtcagcgacgacggcggcgcgcactggaaggtc
ggcgccaccgacacctggcccgtcgcggccgacggcaccttccggcagaagccctccgaa
ctgaccctcaccgagcgcgccgacggagccctcctggtcagcgggcgggaggagcggggc
accgacctcggccaccgcacccaggccctcagcctggacggcggcgacagcttcgcggcc
cccttccgcgccctgcccgacctgtacacgccgcaggtgcagggcgccgtgctccgcatg
ggcgaccgcacgctgctgtccgccccggccgatccggaccgccgccggacgatgtccgtg
cgctcctcctacgacggcggcgcgacctgggacagcgtggaccgcgggaccgtcctcacg
cgggactggtccgggtactcggacatggtggacgtcgacgacgcgacggtgggcctcctg
tacgaggccggagccgtcgacgcccgcgacgagatccgcttcgcccgcttcaccgaggac
tggctccaggcccgccgggccgccgaccccaccacaccggacctcgcgcccggcgcggcc
cccgccgcggtgctgggcggtgccggaccgacgaccggcgcggtgggcggcgccctctcc
ttcgacggcgccgacgacgccgtgcggctgccgttcgacgagcggctgccgctgggggac
ggggacttcaccgcgtcgctgcggttccgttactcggaggccgacggggagcagccgctg
ctgtggatgggcggggtggggatcgcgcagccgcaggtgtggctgcgggccgagcccgct
cacggcagggtccaggggctgatcaccgcgcgcgatggggcggcagccccccgctctgcc
tgggtgcgcaccgacgacgccctcaacgacgggcgctggcaccatctggcgctccgccgg
ggcggggggcggctcacgctcttcgtcgacggcgagcagaccggcgcggcggacgtgccg
ggctcggtcagcaccgggtcgcccttcggtgtgcacgtcggggagcgggtggacggccgg
gcccggctgagaggcgcggtcgacgaggtgcacgtctggaaccgggcgctgaccgacgag
gagatcgccgcgggcgacccgccgtccgcgctcgcaaacgccgtggtgcacctgcccctg
gacgggacgagcgcgggcggctga

DBGET integrated database retrieval system