KEGG   Serratia proteamaculans: Spro_0346
Entry
Spro_0346         CDS       T00595                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01957  N-3-fumaroyl-(S)-2,3-diaminopropanoate amidotransferase [EC:6.3.5.-]
Organism
spe  Serratia proteamaculans
Pathway
spe00997  Biosynthesis of various secondary metabolites - part 3
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
Module
spe_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Spro_0346
Enzymes [BR:spe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.-  
     Spro_0346
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC DUF3700 DUF5891
Other DBs
NCBI-ProteinID: ABV39456
UniProt: A8G8L6
LinkDB
Position
397882..399714
AA seq 610 aa
MCGIAGVINFHRQPAQPPLLASMLAALTHRGPDQEGTYHQGHVSIGMRRLKIIALDNGAQ
PCYSNDGRYVLVFNGEIYNYRALRAELIAQGFRFDTESDAEVIVNLYQRDGEAFYQRLDG
MFALAIYDRISDTLLLARDPAGKKPLFYALRDGVVSFSSELNSLLKDQSIPRRIDPVALD
YYLRFRVVPGDRCIFQGISKVPAGGGVSFTLGQESRQHYWRVAYRPTEDDKPLEQWVDEI
DEYLNQAIAKRLMAEVPIGTMLSGGLDSSLITAIACRQGRRELKTFAVGFNESAFSELDY
SRRLAKDLGTEHHDYIITPQEAFDAAHGLVSHFGEPFAFPSSIASHFMYRLARQHVTVVL
GGDGADELFGGYARYSLVANFPHLPTEHNLPRKVDLFNKTWQADAFPEFYQALLTDGAGG
QLRQQLYSRQMALQLAEENSVAQVRSYSDELTQRPDPLSAAMEYDFNHWMQEAQMVKVDI
ASMANSLEVRVPFLDKQVVGLGSSLPARFKLHAGKEKYLLHCLAKRYLPDYIVNRKKQEL
AVPLEQWMVSSMKTRIIDTLTSEQALSRGYFNPDRLRQFVREFDAGHSYALWTMYMLEKW
HQQFVDNQES
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgtgtggtattgcaggcgtcatcaactttcatcgccaaccggcgcagcccccactgtta
gcgtcgatgttagccgctctgacgcaccgtggtcccgatcaagagggcacctatcatcaa
gggcatgtcagcattggcatgcgacgtttgaaaatcatcgcgctggataacggcgctcag
ccctgctacagcaatgatgggcgatatgtattggtgtttaacggtgagatctataattac
cgggctctgcgcgctgagttaatagcgcagggatttagattcgacactgaatccgacgcg
gaagtgatagttaacctgtatcaacgcgacggtgaagccttttatcagcgtctggatggc
atgttcgctctggccatttacgacagaatcagcgatacgctgctgctggcccgcgatcca
gccggcaagaaaccgctgttttatgcccttcgcgacggggtagtcagcttttcgtccgag
ttgaactccttactgaaggatcaaagcatcccacgccgtatcgatcctgtggcgctggat
tattatctgcgctttcgtgtggtgccgggcgatcgctgcattttccagggcatcagtaaa
gtgcctgccggtggcggcgtcagcttcacgctcgggcaagaaagccgacagcactattgg
cgcgtggcctatcggccgacggaggatgacaagccgctggaacagtgggttgacgagatc
gacgaatatttgaatcaggctatcgccaaacgcttgatggcggaagtgccgatcggcacc
atgctaagcggtgggcttgattccagcctgattactgccatcgcctgccggcagggccgg
cgtgagctgaaaaccttcgccgtgggtttcaatgaatccgccttcagtgaactggattat
tcccgacgcctggcgaaagatctcggcaccgaacatcatgattacattattacaccacag
gaggcatttgacgcagcacatgggttggtcagccacttcggcgagccttttgcgttcccc
tcttcgatagccagtcactttatgtatcgtctggctcgtcaacatgtgacggtggtgctg
ggcggcgatggcgccgacgaactgtttggcggctatgcccgctactcgctggtggccaat
ttccctcatttacccaccgagcataacctgccgcgcaaggtagacctgttcaacaagacg
tggcaggcggatgcattccccgaattttatcaggcgctgttgaccgatggcgcaggcggc
cagttgcgccaacagctctacagccgacaaatggcgttgcagttggccgaggaaaatagc
gtggcgcaagtcagaagctacagcgatgaattgacgcagcgtcccgatcctctttccgct
gctatggaatatgatttcaatcattggatgcaggaagcgcagatggtcaaggtagacata
gcctcgatggccaattcgctcgaggtgcgcgttccgttcctggacaagcaggtcgtcggg
cttggcagcagtttgccggcgcggttcaaactgcacgcaggcaaggagaaatatctgttg
cactgtctggcgaaacgctaccttcccgactatatcgttaatcgcaaaaaacaggagttg
gcagtgccattggagcagtggatggtgtcgtcgatgaaaacgcgcatcatcgacacgctg
accagcgagcaggcgctgtcgcgcgggtattttaatcctgacaggctgcgccagttcgtc
agagaattcgacgctggccacagctacgcgttgtggacaatgtatatgctggaaaaatgg
caccagcagtttgtagacaatcaggagtcgtga

DBGET integrated database retrieval system