KEGG   Serratia proteamaculans: Spro_3018Help
Entry
Spro_3018         CDS       T00595                                 

Definition
(GenBank) ADP-ribosyl-(dinitrogen reductase) hydrolase
  KO
K05521  ADP-ribosyl-[dinitrogen reductase] hydrolase [EC:3.2.2.24]
Organism
spe  Serratia proteamaculans
Brite
KEGG Orthology (KO) [BR:spe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Spro_3018
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.24  ADP-ribosyl-[dinitrogen reductase] hydrolase
     Spro_3018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-ProteinID: ABV42119
UniProt: A8GG79
LinkDB All DBs
Structure
PDB: 

Position
3322516..3323616
Genome map
AA seq 366 aa AA seqDB search
MIDLREDTWTLQLYAQRYKGLSPKNSRELQLRMEYDPLKPNLPTSGEEQNSKPEWLNTPP
CLIPESESLDKAKGALVGLAIGDAIGTTLEFLPRDKLHVNDMVGGGPFRLQPGEWTDDTS
MALCLAESYISAGRLDITLFREKLVRWYRHGENSSNGRCFDIGNTTRNALEQYLKHGASW
FGNTEPETAGNAAIIRQAPTSIFRRKSLQRTFADSDSQSMATHCAPESMASCQFLGFILN
YLINGSSREKAFSPHVMPLPVRVLLINAGEYKEKKRDEIRSSGYVIDTLEAAMWAVWNTD
NFHDAILLAANLGDDADSVAATTGQIAGALYGYSNIPKPWLDKLVQQERISNLAEQLFYM
APEEDF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacttacgtgaagacacttggacattgcaactttatgctcaacgttacaagggg
ttatccccaaagaactcacgcgagctacaattgagaatggaatatgatcctttaaagccc
aatttgcctacatctggagaagagcagaatagcaagccagaatggctcaatacacctccc
tgcttaattccagaaagcgaatcactagataaagccaaaggtgctttagtcggtttagct
ataggagatgctattggcaccactcttgagtttcttcctcgagataagcttcatgttaac
gatatggtgggtggcggcccattcaggttacaaccaggcgagtggacagacgatacctca
atggctctttgtttggcagagagttatatttccgcaggccgtttagatattactttattc
cgcgaaaaattagttcgctggtatcgccacggagaaaatagctcaaacggacgatgcttt
gacataggaaatacaaccaggaatgctttggaacaatatttaaaacacggagcgagttgg
tttgggaatacagagcctgaaactgctggtaatgctgcaataatacgacaggcccccaca
tcaattttcagaaggaaatcactacaacgaacatttgcagactcagactcacaaagcatg
gcgacccactgtgcacctgaatctatggccagctgccaatttttaggttttatactaaat
tatctaattaatggaagcagcagagagaaagcattctcaccacacgtcatgccacttcca
gttagagtcctattaataaatgctggcgaatacaaggaaaaaaaacgtgacgaaattcgt
tcaagtgggtatgtaatagacactttagaagcagcaatgtgggctgtgtggaataccgat
aacttccacgatgctattttacttgcagcaaacctgggtgatgatgctgatagtgtggcc
gctacaactggacaaatagcaggagcactatatggatattcaaacatcccaaaaccatgg
cttgataagctcgtccaacaagagagaatatctaatcttgctgaacaattattttatatg
gctcccgaagaggatttttag

DBGET integrated database retrieval system