KEGG   Serratia proteamaculans: Spro_4306Help
Entry
Spro_4306         CDS       T00595                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
spe  Serratia proteamaculans
Pathway
spe00250  Alanine, aspartate and glutamate metabolism
spe00410  beta-Alanine metabolism
spe00640  Propanoate metabolism
spe00650  Butanoate metabolism
spe01100  Metabolic pathways
spe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Spro_4306
   00650 Butanoate metabolism
    Spro_4306
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spro_4306
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spro_4306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spe01007]
    Spro_4306
Enzymes [BR:spe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Spro_4306
Amino acid related enzymes [BR:spe01007]
 Aminotransferase (transaminase)
  Class III
   Spro_4306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABV43400
UniProt: A8GJW0
LinkDB All DBs
Position
complement(4774519..4775784)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGVGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIEKQLKAFTHTAYQIVPYESYVTLAERINQRAPIEGPCKTAFFTTGAEAVENAVKI
ARAHTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPAEFMQALRTLCDEHGILLIADEV
QTGFARTGKLFAMDHYSVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAALAVLEVIEEEQLCQRSQRLGQHLVEVLQQARQTSKAIVDIRAQGSMVAVEFND
PATGKPSAEITRQVQQKALAEGLLLLSCGVNGNVIRFLYPLTIPEDQFTKALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaattgaatcaacgtcgtcaggatgccaccccgcgtggggtaggcgtg
atgtgtggtttttacgcagagcgtgcagagaacgccacgctgtgggatgtcgaaggcaat
gaagtcatcgatttcgcctctggtattgccgtattaaataccggtcaccgccacccgaag
gtgatcgccgcgattgaaaagcaactgaaggccttcacccacaccgcttaccaaattgtt
ccttacgaaagctacgtcacgttggcggaacgcattaaccagcgcgcgccaattgaaggc
ccatgtaaaaccgcattcttcaccaccggtgccgaagcggtagagaacgcggtcaaaatt
gcccgtgctcataccggtcgtccaggtcttatcacctttggcggcggtttccacggccgt
acctatatgaccatggcgctgaccggcaaagtggctccttacaaactgggcttcgggcca
ttccccggttcggtgttccacggtcagtacccaaatgcgctgtacggcgtgaccaccgaa
gacgcgatgaacagtctggaacgtatctttaaagcggatatcgatcccaagcaggttgcg
gccatcgtgctggagccggtgcagggtgagggtggtttcaacatcgcaccggccgagttt
atgcaagcgctgcgcacgctgtgtgacgagcacggcattctgctgattgctgacgaagtg
cagaccggttttgcccgtaccggcaagctgttcgccatggatcattacagcgtgaaaccc
gatctaatcaccatggcgaaaagcctggcgggcggtatgccgctgtcggcggtggccggg
cgtgccgaagtgatggatgctccagcaccgggtgggctgggtggcacctatgccggtaac
ccgctggcggtggcggcagcgttggcggtgttggaagtgattgaagaagagcaactgtgc
cagcgttcgcagcgcctggggcagcatctggtggaggtgttgcagcaggcgcgccagacc
agcaaggcgatcgtggatatccgcgcgcaaggctcgatggtggcagtggagttcaacgat
ccggcgaccggcaagccttcggcggagattacccgtcaggtacagcaaaaagcgctggca
gagggcctactgttgctgagctgcggcgtcaacggcaacgtgatccgtttcctgtatccg
ctgaccattcctgaagaccagttcaccaaggcgctgggcattctttcccgcgcgctggcc
caataa

DBGET integrated database retrieval system