KEGG   Solanum pennellii: 107008743
Entry
107008743         CDS       T04130                                 

Definition
(RefSeq) uracil-DNA glycosylase, mitochondrial
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107008743
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107008743
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     107008743
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107008743
 Prokaryotic type
     107008743
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 107008743
NCBI-ProteinID: XP_015063376
LinkDB
Position
2
AA seq 320 aa
MASSSSKTLKDLWKQPAAKRLKQVSSTENFISSALASSSSRKDCDEDPKDVVSSTPEQNS
RMEFNRSLAKSKRNLKLCSDKISKLNANGEGGGYVKLQELLIEETWLEALPGEFEKTYAG
NLCKFVEKEISGGVPIYPPLHLIFNALNTTAFDRIKAVIIGQDPYHGPGQAMGLSFSVPK
GVKVPSSLLNIYKELKQDLGCSIPIHGNLEQWAVQGVLLLNAVLTVRHHQANSHANKGWE
QFTDAIIKTISKKKEGVVFILWGNYAQAKARLVDETKHHILKSAHPSGLSANRGFFGCRH
FSQTNQLLEKMGMPPIEWQL
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcgtcttcttcatccaaaaccctaaaggacctatggaagcaaccagcagcaaagcgt
ctaaaacaggtgtcttctaccgaaaacttcatttctagcgccttggcatcttcatcttcg
cgtaaagactgtgacgaagaccccaaagacgtagtatcctcaacgccggagcaaaattcg
agaatggagttcaaccgatcactcgcaaagtccaaaaggaacctcaaactatgttctgat
aaaatctccaaattaaacgcaaacggtgaagggggtggatacgtgaagttacaggaactg
ttgattgaggagacatggttggaagcattgccaggggaatttgagaagacctatgcaggg
aacttgtgcaaatttgtggaaaaggaaattagtggtggtgtcccaatttatcctccacta
catctgatttttaatgctcttaacactactgcatttgacaggataaaggctgtcattatt
ggacaggatccatatcatggaccaggtcaggcaatgggcctgtctttctcggtgcctaag
ggtgtgaaagtcccttctagtctgttgaatatatataaagaacttaagcaagatttgggc
tgttcaataccaattcatggaaatctggaacaatgggctgtgcagggcgttctgcttctc
aatgctgttctaacagtcaggcatcatcaggcaaattcacatgcaaataaaggctgggag
caatttacagatgctatcatcaaaacaatttctaagaagaaagaaggagttgttttcatt
ctgtggggaaactatgcccaagcaaaagccaggttagttgatgaaacaaagcaccatatt
ctcaaatcagcacacccttctggattgtctgcaaacagaggtttctttggatgccggcat
ttttcacagacaaaccaacttttggaaaagatgggaatgcctcccattgaatggcaacta
taa

DBGET integrated database retrieval system