KEGG   Solanum pennellii: 107015682
Entry
107015682         CDS       T04130                                 

Definition
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase, chloroplastic
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107015682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107015682
Enzymes [BR:spen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     107015682
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     107015682
SSDB
Motif
Pfam: Exo_endo_phos SAP SAP_new25 HeH Tau95_N Exo_endo_phos_2
Other DBs
NCBI-GeneID: 107015682
NCBI-ProteinID: XP_015071504
LinkDB
Position
4
AA seq 539 aa
MLQSFKFGLYNFITSNSVGVILRKPKFQVLVSVNLTIMGSKKRPFSTSSATGKSNEQVSV
AAEKGVSKENGGKSGEVLVEDMETVEKMTVPQLRVKLRSLGIPSRGTKQELVASLKTFLD
SKLDDAGNGSVAQEDKVSSEESLEVAANPSKKKSRKVPSKNRNQSNVTSKVPTTRQTKKR
VTKGQTEDTSFDIIVKETEITQEMSIESNDIKGKKNVRAKRKVSSATASAHIGVSEAADL
SVNQDEPWTIFAHKKPKDGWIVYNPKTMRPPPLSKDTKHVKLLSWNVNGLRALLKLKNLC
IQQLADREDFDVICLQETKLQEKDVEAIKESLHDYKNSFWTCSVSKLGYSGTAIISRIKP
VSIKYGLGIPDHDTEGRLVTVEFDNFYLLCGYVPNSGDGLRRLTYRITEWDPSLGSYMKE
LEKSKPVVLTGDLNCAHEEIDIYNPTGNKRSAGFTEEERRSFETNFLNKGFVDTFRKQHP
GVVGYTYWGYRHGGRKTNKGWRLDYFLVSECISEKVHDSYILPDVDGSDHSPIGLVLKL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgttacaatcttttaagtttggtctttacaatttcatcacttccaatagtgttggagtc
attttaaggaaacccaagtttcaggttttggtttctgtgaatttgacgataatggggtct
aaaaaaagacccttttcaacctcatcagctactggaaaatcaaatgaacaagtgagtgtt
gcagctgaaaagggtgtttcaaaggaaaatggtggcaagagtggggaggttcttgtggag
gatatggaaacagtagagaaaatgactgttcctcagctcagagtaaaacttaggagtctt
gggattccttccagaggtactaagcaagaacttgttgcttctttgaagactttcctcgac
agcaaacttgatgatgcaggcaatggatctgtggcacaggaggataaagtatcatctgag
gagagtctagaagtagcagctaacccttcaaaaaagaagtccagaaaagtgccaagtaag
aatcgcaaccaaagcaacgtcacatccaaggttcctactactcggcagacgaaaaaacga
gtcacaaaaggccagactgaggataccagttttgacattattgttaaagaaactgaaatt
acccaagaaatgtccattgaatctaatgatatcaaaggcaagaaaaatgtacgagcaaag
agaaaagtttcatcggcgactgcttcagcacacataggagtttctgaggctgctgatctt
tctgtaaatcaagatgaaccttggactattttcgctcacaagaagcccaaagatgggtgg
attgtatacaatcctaaaacaatgaggccacctcctctttcaaaggatactaaacatgtt
aagttattgtcttggaatgtcaatggtctgagggctctattaaagttgaagaatctttgc
atacagcagcttgctgatagagaagattttgatgtaatatgcctacaggagactaaacta
caggaaaaagacgttgaagcgatcaaggaaagtctccatgactataagaatagcttttgg
acatgcagtgtctctaagcttggatattctggtactgcaatcatctcacgaattaaacca
gtttctatcaaatatggtctcggtataccagatcatgatactgaaggacgacttgttacg
gtggaatttgataacttctatttattgtgtggatatgttccaaattctggtgatggacta
cgccgattgacatacagaattaccgagtgggatccttctcttggcagttacatgaaagag
ctagagaagtcgaaacctgttgttttgaccggtgatctaaattgtgcccatgaggagata
gatatttataatcctactggaaataaaagaagtgcaggctttactgaagaagaaagacgg
tctttcgaaacgaactttctaaacaaggggtttgtagatacattcaggaagcagcatcct
ggtgttgttggttatacttattggggttaccgccatggtggacgtaaaactaataaagga
tggcggcttgactacttccttgtctcggaatgcatttctgagaaggtgcatgactcgtac
attctgccagatgtagatggcagcgatcacagtcccattggccttgtcctgaagctgtag

DBGET integrated database retrieval system