KEGG   Staphylococcus pettenkoferi: CEP67_04635Help
Entry
CEP67_04635       CDS       T04943                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
spet  Staphylococcus pettenkoferi
Pathway
spet00010  Glycolysis / Gluconeogenesis
spet00071  Fatty acid degradation
spet00280  Valine, leucine and isoleucine degradation
spet00310  Lysine degradation
spet00330  Arginine and proline metabolism
spet00340  Histidine metabolism
spet00380  Tryptophan metabolism
spet00410  beta-Alanine metabolism
spet00561  Glycerolipid metabolism
spet00620  Pyruvate metabolism
spet00625  Chloroalkane and chloroalkene degradation
spet01100  Metabolic pathways
spet01110  Biosynthesis of secondary metabolites
spet01120  Microbial metabolism in diverse environments
spet01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEP67_04635
   00053 Ascorbate and aldarate metabolism
    CEP67_04635
   00620 Pyruvate metabolism
    CEP67_04635
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEP67_04635
   00561 Glycerolipid metabolism
    CEP67_04635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEP67_04635
   00310 Lysine degradation
    CEP67_04635
   00330 Arginine and proline metabolism
    CEP67_04635
   00340 Histidine metabolism
    CEP67_04635
   00380 Tryptophan metabolism
    CEP67_04635
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEP67_04635
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CEP67_04635
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CEP67_04635
Enzymes [BR:spet01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CEP67_04635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: ASE37976
LinkDB All DBs
Position
complement(968772..970199)
Genome map
AA seq 475 aa AA seqDB search
MRNYNKQYINGEWVESASGETLEVINPATEEVLGTIAAGNKEDVDKAVEAADQVAVEFRH
SSVEERKELLDKILQEYKNRKQDIIEAITDELGSPLKVSEDVHYQAGINHFQAARDALDS
FEFEERRGDDLVVKEGIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPYAAI
ILAKIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGGTGSKIMEKASKDFK
KVSLELGGKSPYIILDDADIEEAAKAATMKVVNNTGQVCTAGTRTLVPESIKDDFLTAVK
KQFEAVKVGDPREEGTQVGPIISKKQFDQVQSYIDKGVEEGAELFFGGPGKPEGLEQGYF
ARPTIFNNVDNKMTIAQEEIFGPVMSIITYNDIDEAIEIANDTKYGLASYVFGKDKETMR
HIAHYIEAGTVELNEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYYK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactataataaacaatatatcaacggtgaatgggtagagagtgcaagcggtgaa
acactcgaagttatcaaccctgcgacagaagaagtattaggaacaatcgcagcaggtaat
aaagaagatgtcgacaaagcggtagaagctgcagaccaagttgcagtggaattccgtcat
agttcagtagaagaacgtaaagaattattagacaaaatcttgcaagaatacaagaataga
aagcaagatatcatcgaagcaattactgatgaattaggttcaccacttaaagtttctgaa
gatgtacactaccaagcaggcatcaatcacttccaagcagcaagagatgccttagattca
tttgaatttgaagaacgtcgtggcgacgacttagtagttaaagaaggtattggtgttgct
ggtctcgtaacaccttggaacttcccgacaaaccaaacttccttgaaacttgcagcagca
tttgcagcaggaagtccagttgtcttgaaaccgtctgaagaaacaccttacgcagcaatt
atcttagctaaaatcttcgataaagtcggtgtacctaaaggtgtgtttaacctcgttaat
ggtgacggtgaaggtgtaggtaatccacttagtgaacaccctaaagtacgcatgatgtca
ttcactggctcaggcggtacaggtagtaagatcatggagaaagcgtctaaagacttcaag
aaagtatcacttgagttaggtggtaaatcaccttatattatccttgatgatgcagatatc
gaagaagcagcgaaagccgcaactatgaaagttgtcaacaacactggacaagtatgtact
gcaggtacacgtacactcgttccagaaagcattaaagatgatttcttaactgctgtgaag
aaacaattcgaagcagtgaaagttggcgatcctcgtgaagagggtacacaagtaggtcca
atcattagtaaaaaacaattcgatcaagttcaatcttatattgataaaggtgttgaagaa
ggtgcagaactcttcttcggtggccctggtaaaccagaaggtctcgaacaaggttacttc
gcacgtccaacaatctttaataatgtagataataaaatgactattgcacaagaagaaatc
ttcggtccggtaatgtcaatcatcacttacaatgacattgacgaagcaattgaaattgcg
aacgatacgaaatacggacttgcttcttacgtcttcggtaaagacaaagaaacaatgcgt
catatcgcacactacattgaagcaggtactgtagaacttaacgaagctggacgtaaacct
gatcttccattcgggggctacaaacaatcaggtttaggtcgtgaatggggcgactacggt
atcgaagaattcttagaagtgaaatctatcgcaggttattacaaataa

DBGET integrated database retrieval system