KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1771Help
Entry
SpyM3_1771        CDS       T00089                                 

Gene name
nox.3
Definition
(GenBank) putative NADH oxidase/alkyl hydroperoxidase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Brite
KEGG Orthology (KO) [BR:spg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SpyM3_1771 (nox.3)
Enzymes [BR:spg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SpyM3_1771 (nox.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C Glutaredoxin FAD_binding_3 Lycopene_cycl Thioredoxin_4 NAD_binding_8 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AAM80378
UniProt: A0A0H2UWQ8
LinkDB All DBs
Position
1792422..1793954
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDR
QPSFKVAKKGHDSGVVFAGLPLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQVAGPLSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMISTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTNNLTIIKNVATKDIVGEDHVTGLSY
TERDSGEDKHLDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccctgttagaagct
gatcttgttttgcaagtttcccttggtgacaatgagcagtctcaaaaagtcaaagacttt
gtggaagaaatagctgctatgtctgagcgtatttctattgaaaacatcactttagaccga
caaccaagctttaaggttgcgaaaaaaggtcacgatagtggggttgtctttgccggcctt
cctttaggccacgaattgacgtcctttattcttgctctcttgcaagtatctggacgtgct
ccaaaagtggatcaagatgttattgatcgcatcaaggccattgaccgtccgttgcatttt
gaaacttatgtcagcttaacctgccataactgcccagatgttgttcaagctttaaacatt
atgtccgtcttgaacgacaagatttcacacactatggtagaaggcggcatgttccaagat
gaagtgaaagccaaaggcattatgtctgtccctactgtctttttagacggggaggaattc
acttctggtcgtgctaccattgagcaactcttagaacaagtcgctggcccactttctgag
gaagcctttgctgataaaggcctctatgatgtccttgttattggtggtggccctgcgggc
aatagcgctgctatctatgcagctcgtaaaggactaaaaacaggtttacttgctgaaacc
tttggtggtcaggtcatggaaactgtcggcatcgaaaacatgattagtaccctttacact
gaaggaccaaaattaatggccgaagtggaggcccatactaagtcttatgatgttgatatt
atcaaagcacaactagctacttctattgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttttacaagccaaaactgctatcttagctcttggggccaaatggcgtaac
attaatgttcctggtgaagatgaattccgtaataaaggggtgacttactgccctcactgt
gacggtcctctctttgaaggcaaagatgttgctgttatcggtggtggtaactccggttta
gaagcggcccttgatttggctggtcttgctaaacacgtttacgttttagaattcttgccc
gagctcaaagctgacaaagtgcttcaagaccgcgcagctaagactaacaatctgaccatc
atcaaaaatgttgctactaaggatattgttggagaggaccatgttacaggtcttagctac
actgagcgtgatagcggtgaagacaaacaccttgaccttgaaggggtctttgttcaaatt
ggtcttgttccaaacacagcttggctcaaagatagtggtgtcaacctaaccgaccgcggt
gaaatcattgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttccatggggtctggtgctactgctgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system