KEGG   Sphingomonas wittichii DC-6: HY78_04315Help
Entry
HY78_04315        CDS       T05200                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sphd  Sphingomonas wittichii DC-6
Pathway
sphd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sphd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    HY78_04315
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sphd03400]
    HY78_04315
Enzymes [BR:sphd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     HY78_04315
DNA repair and recombination proteins [BR:sphd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     HY78_04315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ARR52724
UniProt: A0A1X9UAA6
LinkDB All DBs
Position
complement(893705..896233)
Genome map
AA seq 842 aa AA seqDB search
MARLDEYNRKRDFAKTREPAGTLETRGRHRFIVQKHDATRLHYDFRLEMDGVLKSWAVTR
GPSLDPEDKRLAVRTEDHPVSYGGFEGTIPEGEYGGGTVMLWDEGSWAPIAGKSELDLDK
GHLHFTLDGHRMKGEWLLVRIKGRPGEKRENWLLRKIDDGEAGGSDDLVAHALTSVKTGR
TMAQIAADKAGESSLKGKRGKAFDAIMAKSDAHNARVARRPAKGKPSTTPPPAFRKPQLA
TLVDHVPTGGAWIHEIKFDGYRALVAVAGDRVKIFTRTGLDWTDRFAPVAEAVAALGLPP
ALIDGEIVSLDAGGNPSFSALQKAIKGEGESGGSGGSGGFELFAFDLLSLDGDDLTGLGT
VERKARLAGLLPRSHPMIHYADHVVGAGEKLFDAMCRAGQEGIISKRADARYRAGRTTNW
LKVKCTRRQEFVIIGWSRSDSAARPFRALLLAQQGEDGLVYAGKVGTGFDRATMEMLAEK
FVARARKTPPADVPRAEAGGASWVRPDLVAEIGFAEFTDEGILRQASFIGLRSDKEAAEV
TAEKPMPVEEAARPEEAPVKISNPDRVIFPEAKATKGDLARYYQAVGPIILPWLGHRPIS
LVRCPQGRAKQCFFQKHDSGSFGEHVHHVPIREKDGKTEDYLYVEDVAGILACVQMGTIE
FHGWGSRVERIEMPDRMIFDLDPDVGLDFADVRTAAKDIRRLLSDIGLTSFAMLSGGKGV
HVVVPLRPEAEWPAVKDFAHRFAEAMAQAEPDRFVATMAKAKRVGRIFIDYLRNQRGATA
VVPYSARARENAPVAAPVAWNELDDFDKAGAFTIKDADRLLKRASSKALKGWGVADQVLP
DL
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctcgacgaatataaccgcaagcgcgacttcgcgaagacgcgcgagccggcc
ggcaccctggagacgcgcggacgccaccgcttcatcgtccagaagcacgacgcgacccgg
ctgcactatgacttccggctggagatggacggcgtgctcaagagctgggcggtgacgcgc
ggccccagcctcgaccccgaagacaagcggctggcggtccgcaccgaggaccatccggtg
tcctatggcggtttcgaggggaccattcccgaaggcgaatatggcggcggcacggtgatg
ctgtgggacgagggcagctgggcgccgatcgcgggcaagagcgagctagacctcgacaag
ggccatctccacttcaccctcgacggccatcggatgaagggcgaatggctgctcgtccgg
atcaaggggcggccgggcgagaagcgcgagaactggctgctccgcaagatcgacgacggc
gaggcgggcggcagcgacgatctcgtcgcgcacgcgctgaccagcgtgaagaccgggcgg
accatggcccagatcgccgccgacaaggcgggcgaatcgagcctgaagggcaagcgcggc
aaggcgttcgacgcgatcatggcgaagtcggacgcgcacaacgcccgggtggcgcggcga
ccggccaaggggaaaccctcgaccacgccgccgccggccttccgcaagccgcagctcgcg
acgctggtcgatcatgtcccgaccggcggcgcctggatccacgagatcaagttcgacggc
tatcgcgccctggtcgcggtggccggggaccgggtgaagatcttcacccgcaccggcctc
gactggaccgaccgcttcgcgccggtggcggaggcggtcgccgcgctcggcctgccgccg
gcgctgatcgacggggagatcgtcagcctcgacgcggggggcaatcccagcttctccgcg
ctgcagaaggcgatcaagggcgaaggcgagagcgggggcagcggcggaagcgggggcttc
gagctgttcgccttcgacctgctctcgctcgacggcgacgacctcaccgggctcggcacg
gtcgagcgcaaggcgcggctcgccgggctgctgccccgcagccacccgatgatccactat
gccgaccatgtcgtcggcgcgggcgagaagctgttcgacgcgatgtgccgcgctgggcag
gaggggatcatctcgaagcgcgccgacgcgcgctaccgcgccgggcggacgaccaactgg
ctgaaggtcaaatgcacccggcggcaggagttcgtcatcatcggctggagccggagcgac
tccgccgcgcgtcccttccgcgcgctgctcctcgcgcagcagggcgaggacgggctggtc
tatgcgggcaaggtcggcaccggcttcgatcgcgcgacgatggagatgctggcggagaaa
ttcgtcgcccgcgcccgcaagaccccgcccgccgacgttccccgcgccgaggcgggcggc
gcgtcgtgggtccggcccgacctggtcgccgagatcggctttgccgagttcacggatgag
gggatattgcggcaggcgagcttcatcgggctgcgatccgacaaggaggccgccgaggtg
acagcggagaagcccatgcccgtcgaggaagccgcccggcccgaggaagcgccggtgaag
atcagcaaccccgaccgggtgatcttccccgaggcgaaggcgaccaagggcgatctcgcc
cgctattatcaggcggtcggtccgatcatcctgccctggctgggccaccgcccgatcagc
ctggtgcgctgcccgcaggggcgggcgaagcaatgcttcttccagaagcatgattcgggc
agcttcggcgagcatgtccaccatgtcccgatccgggagaaggacggcaagaccgaggat
tatctctatgtcgaggacgtcgccggcatcctcgcctgcgtccagatggggacgatcgag
ttccacggctggggctcgcgggtcgagcggatcgagatgcccgaccggatgatcttcgat
ctcgatcccgatgtcggtctcgatttcgccgacgttcgcacggcggcgaaggacattcgc
cggctgctgtccgacatcggcctgaccagcttcgcgatgctgtcgggcggcaagggcgtg
cacgtcgtcgtgccgctgcgtcccgaggcggagtggccggcggtcaaggacttcgcccat
cgcttcgccgaggcgatggcgcaggccgagcccgaccgcttcgtcgcgaccatggccaag
gcgaagcgggtcggccgcatcttcatcgactatctgcgcaaccagcgcggtgcgaccgcg
gtcgtcccctatagcgcgcgggcgcgcgagaacgcgcccgtggcggcgccggtggcctgg
aacgagctcgacgatttcgacaaggcgggcgccttcacgatcaaggatgccgaccggctg
ctcaagcgggcgtcgtcgaaggcgctcaagggctggggcgtggcggaccaggtgctgccg
gacctgtga

DBGET integrated database retrieval system