KEGG   Sphingomonas sp. WHSC-8: TS85_18230Help
Entry
TS85_18230        CDS       T03848                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    TS85_18230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sphi03400]
    TS85_18230
Enzymes [BR:sphi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TS85_18230
DNA repair and recombination proteins [BR:sphi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     TS85_18230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AJP73319
UniProt: A0A0C5LJ70
LinkDB All DBs
Position
complement(4034458..4036890)
Genome map
AA seq 810 aa AA seqDB search
MADTPLARYNAKRDFGLTEEPEGLVAATGGNRFIVQKHDATRLHWDFRLEVDGVLKSWAV
TRGPSLDPDEKRLAVRTEDHPLSYADFEGTIPKGQYGGGTVMLWDDGVWEPVKGKSAKDL
DKGHLHFRLDGHRMKGEWLLIRLKPRGKEKAENWLLRKLDDGYAGATDALVETGLTSVAT
GRTMQEIAEGAAVVATSGPPPTPPASGRGAKPPPFQPVQLATLVDSVPTGSDWLHEVKYD
GYRALLATGKAAKVYTRSGLDWTEKFPGIAEAAAGLPPGALIDGEIVAFKEGRPDFSTLQ
DAISNGGAGLTLFAFDLLQDAGEDLTALGQLARKERLRALLAGADARIQFSEHIVGAGEQ
LFETMCREGYEGIVSKRAAAPYRGARTKSWLKVKCTRRQEFVIIGWMPSTAKGRGFRSLL
LGVNGPEGLVYAGKVGTGFSTDTLHALRETLDGIATDKAPLSVPRAESRGAHWVKPELVA
EIAFAEFTAEKVVRHASFLGLRGDKKPAEVVAETPVPLPEPVATSHIKISSRDRVIYPEA
GLTKGQLADYYAAVAPIALRWLGNRPISLVRCPQGRAKQCFFQKHDAGSFGDDVHHVDVR
EKDGSTEPYLYIDSLDGMLACVQMGTIEFHGWGSLVADIEKPDRLVFDLDPDEGLDFEAV
KKAAADLKDHLADMGLTSWPLLSGGKGVHVVVPLVPRVEWPEVRSFAERFARALAQAEPD
RFTANLKKASRTGKIFIDYLRNQRGATAVLPYVARAREGAPVAAPVTWTELRTIDSAKLY
SIRDAATLIERAQSRALQGWGEAAQALPDV
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgcccctcgcccgatacaatgccaaacgcgatttcggtctgaccgaggag
cctgaggggctggtcgccgcgactgggggcaaccgtttcatcgtgcagaagcatgacgcg
acgcggctccactgggatttccggctcgaagtggacggggtgctcaagagctgggcggtg
acgcgcgggccgagcctcgatccggacgagaaacggctcgcggtgcggaccgaggaccat
cctttgtcctatgccgatttcgaggggacgatccccaagggccaatatggcggcggcacg
gtgatgctgtgggatgacggcgtgtgggagccggtcaagggcaagtcggcgaaggacctc
gacaaggggcatctccacttccggctcgacgggcaccggatgaagggcgagtggctgctg
atccggctgaagccgcgcggcaaggaaaaggccgagaactggctgctgcgcaagctcgac
gacggctatgcgggcgcgaccgacgcgctggtcgagaccgggctgaccagcgtcgccacc
gggcggacgatgcaggagattgccgagggcgcggcggtcgtggctacctcaggccctccc
ccgacccctcccgcaagcggaaggggagccaaaccgccccccttccagccggtgcagctt
gcgacgctggtggacagcgttccgaccggcagcgactggctgcacgaggtgaagtatgat
ggctatcgcgcgctgctcgccacgggcaaggcggcgaaggtctacacccgctcgggcctc
gactggaccgagaaatttcccggcatcgccgaggcggcggcgggccttccccccggcgcg
ctgatcgatggcgagattgtcgcgttcaaggagggcaggcccgatttctcgacgctccag
gacgctatttcgaacggaggcgcggggttgacgctattcgcgttcgacctgctccaggac
gcgggcgaggacctcaccgcgctcgggcagctcgcccgcaaggagcggctccgcgcgctg
ctggcgggtgcggacgcgcgcatccagttttccgagcatatcgtcggcgcgggcgagcaa
ttgttcgagacgatgtgccgcgaaggctatgaggggattgtgtcgaagcgcgccgccgcg
ccctatcgcggcgcgcggaccaagagctggctcaaggtcaaatgcacccgccgccaggaa
ttcgtgattatcggctggatgccgagcaccgcgaaggggcgcggcttccgctcgctgctg
ctcggcgtcaacgggcccgaggggctggtctatgcggggaaggtcgggaccgggttcagc
accgatacgctccacgcgctgcgcgagacgctggacgggattgcgaccgacaaggcgccg
ctgagcgtgccgcgtgccgagtcgcggggggcgcactgggtgaagcccgagctggtcgcc
gagatcgcctttgccgaattcactgccgagaaggtcgtgcgccatgcgagtttcctcggg
ctgcgcggcgacaagaagccggcggaggtggtcgccgaaacccccgtgccgctccccgag
cccgtcgcgacgtcgcacatcaagatcagcagccgcgaccgggtgatctatcccgaggcg
gggctgaccaaggggcagctcgccgattattacgccgcggtcgcgccgatcgcgctgcgc
tggctgggcaatcgcccgatcagcctggtccgctgcccgcaggggcgggcgaagcaatgt
ttcttccagaagcacgatgccggcagctttggcgacgacgtccaccatgtcgatgtgcgc
gagaaggacgggtcgaccgagccctatctctatatcgacagcctcgacgggatgctggcg
tgcgtccagatggggacgatcgagtttcacggctggggcagcctggtcgccgatatcgag
aagcccgatcggctggtgttcgacctcgaccccgatgaggggctcgatttcgaggcggtg
aagaaggcggcggcggacctcaaggaccatctcgcggacatggggctgacgagctggccg
ctgctgtcggggggcaagggcgtgcatgtcgtggtgcctttggtcccgcgtgtcgaatgg
cccgaggtgcgcagcttcgccgaacgcttcgcgcgcgcgctggcccaggccgagcccgat
cgcttcaccgccaacctgaaaaaggccagccggacggggaagatcttcatcgattacctg
cgcaatcagcgcggcgcgaccgccgtgctcccctatgtcgcccgcgcccgcgaaggcgcg
ccggtggcggcgcccgtcacctggaccgagctgcgcaccatcgacagcgccaagctctac
tcgatccgcgacgccgcgacgctgatcgagcgcgcgcaaagccgggcgttgcagggatgg
ggcgaggcggcgcaggcgctgccggacgtatag

DBGET integrated database retrieval system