KEGG   Sphingopyxis sp. MG: C3E99_12550Help
Entry
C3E99_12550       CDS       T05382                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spho  Sphingopyxis sp. MG
Brite
KEGG Orthology (KO) [BR:spho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C3E99_12550
Enzymes [BR:spho01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C3E99_12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 K_oxygenase NAD_binding_8 NAD_binding_7 Thi4 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AVA14569
UniProt: A0A2L0VRN6
LinkDB All DBs
Position
complement(2725755..2727338)
Genome map
AA seq 527 aa AA seqDB search
MLDASLKQQLQAYMANIREPIELLSSLDDGPKSAELAGLLDEIASLSDKVSVARTDDDAR
RPSFLIRRVGAPDVAVRFAGIPLGHEFTSLVLALLQVGGHPSKAAPELLDQVRGLDGDYH
FETYFSLSCQNCPDIVQALNLMSVLNPRITHTAIDGALFQGEVEARQVMAVPTIFLNGET
FGQGRMELEQILAKLDSGAEAKAAERIAAKDPFDVLVIGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVTHTEGPKLAAQLEQHVKEYDVDIMNLQRAEELIPAKREG
GLHEVRLANGASLKARTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEFDAELRADAVLQRKLASLPNVRIITSALTTEVLGD
GGKVTGLSYKDRNKDTLHQVELEGIFVQIGLVPNTEWLSGAISLSRRGEIEVDHRGETSQ
PGIFAAGDCTTVPYKQIVIAMGEGSKAALSAFDYMIRLPAEAEVEVA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcatcgctcaagcagcagcttcaggcctatatggccaacatccgcgaaccg
atcgaactgctctcgtcgctcgacgacggcccgaagtcggccgagctggcgggcctgctc
gacgagatcgcgtcgctgtcggacaaggtcagcgtggcgcgcaccgacgatgacgcgcgc
cgtccgagcttcctgatccgccgcgtcggcgcgcccgatgtggcggtgcgtttcgccggc
atcccgctcggccatgaattcacctcgcttgtccttgcgctgctgcaggtcggcggccat
ccgtccaaggccgcgcccgaactgctcgaccaggtccgcgggctcgacggcgactatcat
ttcgaaacctatttctcgctgtcgtgccagaactgtcccgacatcgtgcaggcgctcaac
ctgatgagcgtcctcaacccgcgcatcacgcacaccgcgatcgacggcgcgctgttccag
ggcgaggtcgaggcacgccaggtgatggcggtgccgacgatcttcctgaacggcgagacc
ttcggccagggccgcatggaactggaacagattctcgcaaagctcgacagcggcgccgag
gcgaaggccgctgagaggatcgccgcaaaagacccgttcgacgtcctagtcatcggcggc
ggccccgcgggcgccgcggcggccatctacgccgcgcgcaagggcatccgcaccggcatc
gccgccgaacgcttcggcggacaggtgctcgacacgatggcgatcgagaatttcatctcg
gtcacgcacaccgaggggccgaagctcgccgcgcaactggaacagcacgtcaaggaatat
gacgtcgacatcatgaacctccagcgcgccgaggaactgatcccggcgaagcgcgagggc
gggctgcatgaggtgcggctggcgaacggcgcgtcgctgaaggcgcgcaccgtgatcctg
tcgaccggcgcgcgctggcgccagatgggcgtgcccggcgaggacgagtatcgcaacaag
ggcgtcgcctattgcccgcattgcgacgggccgctctacaagggcaagcgcgtcgcggtg
atcggcggcggcaattcgggggtcgaggcggcgatcgacctcgccgggatcgtcgcgcat
gtgacgctgatcgagttcgacgccgaactgcgcgccgacgccgtgctccagcgcaagctc
gcgagcctgcccaacgtgcggatcatcacctcggccctgaccaccgaggtgctcggcgat
ggcggcaaggtgacgggcctgtcgtacaaggaccgcaacaaggacacgctgcaccaggtc
gaactggagggcatcttcgtccagatcggccttgtccccaacaccgaatggctgtcgggc
gcgatcagcctgtcgcggcgcggcgagatcgaggtcgaccatcgcggcgagacgagccag
cctggcatcttcgcggcgggcgactgcaccaccgtgccctacaagcagatcgtcatcgcc
atgggcgaagggtcgaaggcggcgctgtcggcgttcgactacatgatccgcctgcccgcc
gaagcggaggtcgaggtcgcctga

DBGET integrated database retrieval system