KEGG   Sphingopyxis sp. QXT-31: BWQ93_13790Help
Entry
BWQ93_13790       CDS       T04913                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sphq  Sphingopyxis sp. QXT-31
Pathway
sphq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BWQ93_13790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sphq03400]
    BWQ93_13790
Enzymes [BR:sphq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BWQ93_13790
DNA repair and recombination proteins [BR:sphq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BWQ93_13790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: APZ99436
UniProt: A0A1P8WZE4
LinkDB All DBs
Position
2869682..2872186
Genome map
AA seq 834 aa AA seqDB search
MARADPLAQYNAKRDFKLTPEPAGKVAKGVGNRFIVQKHDATRLHYDFRLEVDGVLKSWA
VTKGPSADPADKRLAVRTEDHPMSYADFEGVIPKGEYGGGSVMLWDCGTWAPIEGKSAKD
IEKGHLHFTLDGERMKGEWLLVRMKPRPGEKRENWLLRKVNDAYAGGSDDLVGRQLTSVL
TGRTMAEIAGDEGGEQSLKGAKGQAFAKKMQAAAAHNRKVAKAKPKGKPPKFRPLQLATL
VDAVPTGNGWFHEIKYDGYRAEIAAAGDEVRVYTRNGLDWTDKFLPLVRHIAALGLPPCL
IDGEIVAYGKDGNPDFSSLQAVLKRGHGAQDEGTALHFFAFDLLEESGKSLAKLGNLERK
ERLEALLRDAQPPVAVADHVIGAGEKLYAAMCGAAQEGIISKRADAPYLGRRSKSWVKVK
CTRRQEFVIVGWNPSAAKARPFASLLLAQHEGGTLVYKGNVGTGFDAATMAELAKKFARL
ERKTAPLEVDAATARKVHWLKPDLVAEIAFAEFTASGSVRHASFLGLRSDKEAKDVTPEK
RQPAPAPESDVTISSRDRIIFPEAKATKGDLADYYEAVAPLMLPHAARRPISLVRCPQGR
GKKCFFQKHDSGSFGDHVHHVPIREKDGGHEDYLYVDDADGLLACVQMGTIEFHGWGSHV
GALEKPDRMVFDLDPDEGLPFADVKKAATDIRRQLADIGLTSFAMLSGGKGVHVVVPLDP
GHSWDAHKDFSKRFAEALSMAEPDRFIATMSKAKRKGKIFIDYLRNQRGSTAILPYSARA
REGAPVAVPIGWDALAEVDKAGAWTIRDADELLERAAGADLKGWGFVSQRLPDF
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgccgatcccctcgcccaatataatgccaagcgcgatttcaagctgaccccc
gagcccgcgggcaaggtcgcgaagggagtcggcaaccgcttcatcgtccagaagcacgac
gcgacgcggctccactatgatttccggctcgaggtcgacggggtgctcaagagctgggcg
gtgaccaagggtccgagcgccgaccccgccgacaagcgcctcgcggtgcgcaccgaagac
catccgatgagctacgccgatttcgaaggcgtgatccccaagggcgaatatggcggcggc
agcgtaatgctgtgggactgcggcacatgggccccgatcgagggcaagagcgcgaaggac
atcgaaaagggccacctccacttcaccttggacggcgaacgcatgaagggcgaatggctg
ctcgtccgtatgaagccgcgccccggcgagaagcgcgagaactggctgctgcgcaaggtg
aacgacgcttatgcgggcggcagcgacgatctcgtcgggcgccagctcaccagcgtcctc
accggccgcaccatggccgagatcgcgggcgacgagggcggcgaacagtcgctgaagggt
gccaagggccaagccttcgccaaaaagatgcaggccgccgccgcgcacaaccgcaaggtc
gcgaaggccaaacccaaaggcaaacccccgaagttccgcccgctccagctcgcaacgctc
gttgacgccgtacccaccggcaacggctggttccacgagatcaagtacgacggctatcgc
gccgaaatcgccgcagcgggcgacgaggtgcgcgtctacacgaggaacggcctcgactgg
accgacaaattcttgcccctcgtccgccatatcgccgcactgggcctgccgccctgcctg
atcgacggcgagatcgtcgcctatggcaaggacggcaatcccgacttctcctcgctgcaa
gccgtgctcaagcgcggccacggcgcgcaggacgagggcaccgccctccacttcttcgcc
ttcgacctcctcgaagaaagcggcaagagccttgccaaactcggcaatctcgagcgcaag
gaacgcctcgaagcgctgctccgcgacgctcagccccccgtcgcggtcgccgaccatgtc
atcggcgcgggcgagaaactctacgccgcgatgtgcggcgccgcgcaggagggcatcatc
tcgaaacgcgctgacgcgccttaccttggccgccgcagcaagagctgggtcaaggtcaaa
tgcacccgccgtcaggagtttgtgatcgtcggctggaacccctccgcagcgaaggcgcgc
cctttcgcctcgctcctcctcgcccagcatgagggcggcaccctcgtctacaaaggcaat
gtcggcaccggcttcgacgccgcgaccatggccgagctcgcgaaaaaattcgcacggctc
gaacgcaagaccgcgccgttggaggtcgacgccgcgaccgcgcgcaaggtccattggctc
aaacccgatctcgtcgccgaaatcgccttcgccgaattcaccgcgagcggatcggtgcgc
cacgcgagtttcctcggcttgcgcagcgacaaggaggccaaggacgtgacccccgaaaag
cggcaacccgcccccgcacccgaaagcgacgtgacgatcagcagccgcgaccgcatcatc
ttccccgaagccaaggcgaccaagggcgacctcgccgattattatgaagccgtcgccccg
ctgatgctcccccacgccgcgcgccgcccgatcagcctcgtccgctgcccgcagggccgc
ggcaagaaatgcttcttccagaagcacgacagcggctcgttcggcgaccatgttcaccat
gtcccgatccgcgagaaggacggcgggcacgaggattatctctatgtcgacgacgccgac
ggcctgctcgcctgcgtccagatggggacgatcgaattccacggctggggcagccacgtc
ggcgcgcttgaaaagcccgaccgcatggtcttcgacctcgatcccgacgagggcctcccc
tttgccgacgtgaagaaggccgcgaccgacatccgccgccagctcgccgacatcggcctc
accagcttcgcgatgctatcgggcggcaagggcgtgcatgtcgtcgtcccgctcgatccg
ggacacagctgggacgcgcacaaggatttctcgaagcgtttcgccgaggcgctcagcatg
gccgaacccgaccgcttcatcgcgacgatgagcaaggccaagcgcaagggcaagatcttc
atcgattatctgcgcaaccagcgcggcagcaccgcgatcctcccctattcggcccgcgcc
cgcgaaggcgcgcccgtcgcggtcccgatcggctgggacgccctcgccgaggtcgacaag
gcgggggcgtggacgatcagggacgcggacgaactgctcgagcgcgccgcgggagcggac
ctaaaaggctggggcttcgtcagccagagacttcccgatttctga

DBGET integrated database retrieval system